KEGG   Comamonas testosteroni TK102: O987_13310Help
Entry
O987_13310        CDS       T03218                                 

Definition
(GenBank) MFS transporter
Organism
ctes  Comamonas testosteroni TK102
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 MFS_1_like Nuc_H_symport MFS_2
Motif
Other DBs
NCBI-ProteinID: AIJ46780
UniProt: A0A076PSS1
LinkDB All DBs
Position
2854554..2855774
Genome map
AA seq 406 aa AA seqDB search
MSYENKLLLILFFTFGIVFFDRLALSFLFPFVSKELDLNNAQLGMLSSILALAWAASGAF
FGAYTDRNGKRKTVLILSVLMFSLCSALSGLVGGFVGLLLLRALMGLAEGPILPLSQTLM
VEASTPSRRGLNMGLLQGSSAGLLGAVIAPPVIVALAVAYGWRTAFYLTCVPGLIAAALI
WRHVRSTDSSGQAEAVPTGSRWALLRERNIWLSVLISCVFMAWFVIIISFAPTYLVNAKG
FEPGTMSAVMSCMGVAWVIWGFAVPAISDRVGRRPALIFFSFVAACCPMAFLHVQSPALL
GGLLLLTYTGLGCFTLFMATIPAETVPRAAMATALGMIMGFGELLGGFVAPTLAGLAADR
WGLDVVMWVAAAGALLAGMLSLGLIETAPRRVGSGLLAAALQESQA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgagctatgaaaacaagctgctgctcattctgtttttcacttttggtatcgtttttttt
gaccgcctggcattgtcgttcttatttccttttgtctccaaggaactggatctgaacaat
gcccagctgggtatgctttcgtcgatcctggcattggcatgggcggcttccggtgcattc
ttcggggcctacacagaccgcaatggcaagcgcaaaacggtgctgattctttcggtactg
atgttttcgctgtgttcggccttgtcgggtctggtgggcggctttgtggggctgttgttg
ttgcgagcgctgatgggtttggcggaagggccgatactgccgctgtcgcagactctgatg
gtcgaagcctctacgccgagccgtcgcggcctcaacatgggcttgctgcagggctcgtct
gcgggcttgctgggcgccgtgatcgcaccgccggtgattgttgcgctggccgtggcttat
ggctggcgcactgcgttctacctgacctgcgttccggggctgattgccgcagcgcttatc
tggcgccatgtgcgaagcacagatagcagcggccaggccgaagccgtgccgacaggctca
cgctgggctctgctgcgtgagcgcaatatctggctgagcgtgctgatcagctgcgtcttc
atggcctggttcgtaatcatcatctcttttgcgccgacctatctggtcaatgccaagggc
ttcgagccgggcacgatgagtgcggtcatgagctgcatgggcgtggcctgggtcatctgg
ggtttcgcagtgcctgccatttcggaccgggtaggtcgccgtcctgcactgatcttcttc
tcctttgtcgcggcctgctgtccgatggcttttttgcatgtgcagtcaccggcgctgttg
ggcggcttgctgttgctgacttacaccggcctgggctgcttcacgctcttcatggccacg
attccggcggagaccgttccgcgagcggccatggccacggccttggggatgatcatgggt
tttggcgagctgcttggtggtttcgtcgccccgacgctggccgggctggcagccgatcgg
tggggacttgatgtggtgatgtgggtggcggctgcgggtgctctgctggcgggcatgctt
tccctggggctgattgaaacagcgcccaggcgcgttggcagcggcttgctggctgccgca
ttgcaggagtcgcaggcatga

DBGET integrated database retrieval system