KEGG   Comamonas testosteroni TK102: O987_27260Help
Entry
O987_27260        CDS       T03218                                 

Definition
(GenBank) peptidase M15
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    O987_27260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ctes01002]
    O987_27260
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ctes01011]
    O987_27260
Enzymes [BR:ctes01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     O987_27260
   3.4.21  Serine endopeptidases
    3.4.21.-  
     O987_27260
Peptidases and inhibitors [BR:ctes01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   O987_27260
Peptidoglycan biosynthesis and degradation proteins [BR:ctes01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   O987_27260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AIJ49503
UniProt: A0A076PUV7
LinkDB All DBs
Position
complement(5792583..5794031)
Genome map
AA seq 482 aa AA seqDB search
MLQTPFFLRKTLSALGASLLALLAQPALAQSLPADTRIPAVVDAALQRAKIPRDAVSLLV
MNVDGRSPPNLAWRTHQAMNPASVMKLVTTYAALDQLGPAYVWRTPVYLGGPVVDGALRG
NLYIQGQGDPKLVLERLWLMLRRLQGMGIKVIVGDIVLDRSAFQLPAHDAAVFDNEPWRP
YNASPDALLINYKAVALNIAPDAGAGVARIQYDPPMFGMENQQTVALAAPASDCGDWRSK
MQLDMNNPQRIAFNGSYPASCGDKSWSIAPAQPERFAAKAIEGMWRELGGKLTGAVRDGS
VPQGLQPAFQLESPALSEVVRDINKYSNNIMAQHVLLTLGMQRTGVASFDSARQSLAQWW
AARWGNAEQPVVDNGAGLSRNASITASGLGQMLQNAWVSPVMPEFVSSMPIVGVDGTLRR
SKSRFAGAAHLKTGSLRDSAALAGYVDGASGQRYVLVAMANHANAAAARTAWDALVDWTA
AQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagacccccttctttcttcgcaagaccctgagcgcgctgggcgcatcgttgctg
gcgctgctggcccagcccgcgctggcgcagtccctgcctgccgacacccgcattcccgct
gtcgtggacgcggcgctgcaacgcgccaagattccgcgcgatgccgtatcgctgctggtg
atgaatgtggatggcagatcgccaccgaacctggcctggcgcacgcaccaggccatgaat
ccggcctcggtcatgaagctggtcaccacctatgcggcgctcgaccagctcggcccggcc
tatgtctggcgcacgcccgtctatctgggcggcccggtggtcgatggtgccctgcgcggc
aacctctacatccagggccagggcgaccccaagctggtgctggagcgcctgtggctgatg
ctgcgccgcctgcaaggcatgggcatcaaggtcatcgtgggcgatatcgtgctggaccgc
agcgcctttcagctgcccgcgcatgatgcggcggtcttcgacaacgagccctggcggccc
tacaacgcctcgcccgatgcgctgctgatcaactacaaggccgtggcgctgaatattgct
cccgatgcaggagctggtgtcgctcgtattcagtacgatccaccaatgtttggcatggaa
aaccagcaaacagttgcgctggctgctcctgcttctgattgcggcgactggcgcagcaaa
atgcagctggacatgaacaatccgcagcgcatcgccttcaatggcagctatccggcaagc
tgcggcgacaagagctggtccatcgcaccggcgcagcccgagcgctttgcggccaaggcc
atagaaggcatgtggcgcgagctgggcggcaagctcaccggcgccgtgcgcgacggcagc
gtgccccagggcctgcagccggcgttccagctggagtctccggcactgtccgaagtggtg
cgcgacatcaacaaatacagcaacaacatcatggcccagcatgtgctgctcaccctgggc
atgcagcgcaccggcgtggccagcttcgactctgccaggcagtcgctggcccagtggtgg
gccgcgcgctggggcaatgccgagcagcccgtggtggacaacggtgcaggcctgagccgc
aatgccagcatcacggccagcggactggggcagatgctgcagaacgcctgggtctcgccc
gtgatgcccgagttcgtctcctccatgcccatcgtcggcgtggacggtacgctgcgccgc
agcaagagccgctttgcgggcgcggcccacctcaagaccggcagcctgcgcgactcggcg
gcactggccggctatgtcgacggtgccagcggccagcgctatgtgctggtagccatggcc
aaccatgccaatgcggccgcggcgcgtacggcctgggatgcactggtggactggacggcg
gcacagtag

DBGET integrated database retrieval system