KEGG   Comamonas testosteroni TK102: O987_28480Help
Entry
O987_28480        CDS       T03218                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00620  Pyruvate metabolism
ctes01100  Metabolic pathways
ctes01120  Microbial metabolism in diverse environments
ctes01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O987_28480
Enzymes [BR:ctes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     O987_28480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Malate_DH Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: AIJ49742
UniProt: A0A076Q232
LinkDB All DBs
Position
complement(6055319..6057628)
Genome map
AA seq 769 aa AA seqDB search
MSDTKPITSIDKRALLRQAALEYHEFPKPGKVAIAATKPMANQHDLALAYSPGVAAPCEE
IVKDPAAAFKYTSRGNLVGVISNGTAVLGLGDIGALASKPVMEGKGVLFKKFAGVDVFDI
EIDEKDPQKLVDVIAALEPTFGAINLEDIKAPECFFVERELRKRMNIPVFHDDQHGTAIT
VAAAMVNALKVAGKKIEEVKLVASGAGAAALACLNLLLEVGLKRENVFVTDIAGVVYEGR
TELMDPDKALFAQKTELRTLGEVIEGADAFLGLSAGNVLKQDMVRKMAARPIIFALANPN
PEIIPEDVKAVRDDAIIATGRTDYPNQVNNVLCFPYIFRGALDCGATTITTSMEIACVHA
IAALAQAEQSEEVAAAYVGEVLSFGPEYLIPKPFDPRLMLVVAPAVAQAAAEAGVAKRPI
QDMDAYREHLKTFVYASGTMMKPIVHAAKKASKKRVAYAEGEEERILRAAQIVVDERIAR
PTLIGRPAIIAQRIEKFGLRMKEGADYDVVNVEHDERYRDFWQSYHRMTERKGITAPIAK
IEMRRRLTLIGSMLLHKGEVDGLICGTWNNTNVHLNYIDQVIGKRSGVTTYACMNGLLLP
ERQVFLVDTHVNYDPTAEQLAEITIMAAEEMMRFGIKPKAALLSHSNFGSSNQPSAVKMR
QTLELLREQAPWLEVDGEMHGDVALDGKARAKLMPNSTLLGDANLLVSPNIDAANISYNL
LKQAAGGGIAVGPVLLGAAKPVHVLTPSTTVRRIVNMTALTVADANVSR
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaccaagcccattacctcgattgataaacgtgcgttgctgcgtcaggcggca
ctggaatatcacgagttccccaagcccggcaaggtggccatcgcggcaaccaagcccatg
gccaatcagcatgatctggccctggcttactcgcccggcgtggctgcgccctgcgaggaa
atcgtcaaggacccggctgcggcgttcaaatacaccagccgcggcaacctggtgggcgtg
atctccaacggcacggcggtgctgggcctgggcgacatcggcgcgctggcctccaagccc
gtgatggagggcaagggcgtgctgttcaagaagttcgccggcgtcgatgtgttcgatatc
gaaatcgacgagaaggacccgcaaaagctggtcgacgtgattgctgcgctggagcccacc
ttcggcgccatcaatctcgaagacatcaaggcgcccgagtgcttcttcgtggagcgcgag
ctgcgcaagcgcatgaacattcccgtcttccacgacgaccagcacggcacggccatcacc
gtggcagcggccatggtcaatgcgctcaaggttgccggcaagaagatcgaagaggtcaag
ctggtggcgtcgggtgccggcgccgcggcgctggcctgcctgaacctgctgctggaagtg
ggtctgaagcgcgagaacgtgttcgtgaccgatatcgccggcgtggtctacgagggccgc
accgagctgatggacccggacaaggcgctgtttgcccagaagaccgagctgcgcacgctg
ggcgaggtgatcgagggcgctgacgccttcctgggcctgtctgccggcaatgtgctcaag
caggacatggtcaggaagatggcggccaggcccatcatcttcgcgctggccaaccccaac
ccggaaatcattcccgaagatgtgaaggcggtgcgcgacgacgccatcatcgccacgggc
cgcacggactaccccaaccaggtcaacaacgtcctgtgcttcccctatatcttccgtggt
gcgctggactgcggcgcgaccaccatcaccacctcgatggagatcgcctgcgtgcacgcg
attgccgcgctggcccaggccgagcagtccgaggaagtggcagccgcctatgtgggcgag
gtgctgagcttcggccccgagtacctgattcccaagcccttcgatccgcgcctgatgctg
gttgtggcgcctgccgtggcccaggctgcggccgaagccggcgtggccaagcgccccatc
caggacatggatgcctaccgcgagcatctgaagaccttcgtctacgcctccggcaccatg
atgaagcccatcgtgcatgccgccaagaaggcctccaagaagcgcgtggcctatgccgag
ggcgaggaagagcgcatcctgcgcgcggcccagatcgtggtggacgagcgcattgcgcgc
ccgacgctgatcggccgccccgccatcattgcccagcgcatcgagaagttcggcctgcgc
atgaaggaaggcgccgactacgacgtggtcaacgtcgagcatgacgagcgctaccgcgac
ttctggcagagctatcaccgcatgacggagcgcaagggcatcaccgcgcccatcgccaag
atcgaaatgcgccgccgcctgacgctgatcggctccatgctgctgcacaagggcgaggtc
gacggcctgatctgcggcacctggaacaacaccaatgtgcacctgaactacatcgatcag
gtcatcggcaagcgcagcggcgtgaccacctatgcctgcatgaacggtctgctgctgccc
gagcgccaggtattcctggtcgacacccacgtcaactacgaccccacggccgagcagttg
gccgagatcaccatcatggccgccgaggaaatgatgcgcttcggcatcaagcccaaggct
gcgctgctgagccactccaacttcggctccagcaaccagcctagcgccgtcaagatgcgc
cagaccctggagctgctgcgcgagcaggcaccctggctggaagtggatggcgaaatgcac
ggcgatgtggctctggacggcaaggcccgcgccaagctcatgcccaacagcacgctgctg
ggtgatgccaacctgctggtctcgcccaatatcgacgccgccaacatcagctacaacctg
ctcaagcaggcggccggcggcggcattgccgtgggcccggtgctgctgggtgcggccaag
cccgtgcatgtgctgacgcccagcaccacggtgcgccgtatcgtgaacatgacggcgttg
accgtggccgacgccaacgtcagccgttaa

DBGET integrated database retrieval system