KEGG   Clostridium tetani 12124569: BN906_00716Help
Entry
BN906_00716       CDS       T02905                                 

Gene name
ddl_2
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ctet  Clostridium tetani 12124569
Pathway
ctet00473  D-Alanine metabolism
ctet00550  Peptidoglycan biosynthesis
ctet01100  Metabolic pathways
ctet01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ctet00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN906_00716 (ddl_2)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN906_00716 (ddl_2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BN906_00716 (ddl_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ctet01011]
    BN906_00716 (ddl_2)
Enzymes [BR:ctet01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BN906_00716 (ddl_2)
Peptidoglycan biosynthesis and degradation proteins [BR:ctet01011]
 Precursor biosynthesis
  Amino acid ligase
   BN906_00716 (ddl_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK GARS_A ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST ATP-grasp Ins134_P3_kin ATPgrasp_Ter NERD
Motif
Other DBs
NCBI-ProteinID: CDI48739
LinkDB All DBs
Position
689642..690547
Genome map
AA seq 301 aa AA seqDB search
MQIGVVMGGVSTEKEISNLTGKYIIENLDKSKYEILPIPINTKFELIDKIKCLEFAFIAL
HGNFGEDGKVQALLETMGVPYSGSGVLASSLCMDKNMSKKILQGEGIKTPKWIILYKNKD
IDFQGIKDIGYPLVVKPNNGGSSIGITIVRKYEELIKAIEEAFKFDEEILIEEYIEGEEI
TCCMLDGKPLPILSIKTKEEFFNYKAKYFEGAAEEKVADLSLELKDEVEKISKKCWKSFK
LKVYGRIDMIIKENEVYVIEINTLPGMTKYSLFPKSAKAYGLSFSELLDNIIELSLKEYE
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataggagtagttatgggaggagtatctacagaaaaagagatatcaaatcttacg
ggtaaatatataatagagaacttagataaaagtaaatatgaaatactccctatacccata
aatacaaagtttgaattaatagataaaataaagtgcttagaatttgcttttattgcatta
catggtaattttggagaggatggaaaagttcaagcccttttagaaaccatgggagtacct
tattcagggtcaggagtgttggcaagttctctttgtatggacaaaaatatgagcaaaaaa
atactacaaggagaggggattaaaactccaaagtggataatattatataagaataaagat
atagactttcaaggtattaaagatataggttatcctttagtagtgaagccaaataatggc
gggtctagtattggcataactatagttagaaaatatgaagaattaataaaagccatagaa
gaggcatttaaatttgatgaagaaattttaatagaggaatatatagaaggagaagagatt
acctgttgtatgttagatggcaagccccttcctatactatctataaaaacaaaggaagag
tttttcaattataaagctaagtattttgaaggggcagcagaggagaaggttgcagatctt
tctttggaattaaaagatgaagttgaaaaaataagtaagaaatgctggaaaagttttaag
ttgaaggtctatggtagaattgatatgattataaaagagaatgaagtatacgtaatagag
ataaatactttaccaggtatgactaaatatagtctttttcctaagagtgccaaagcttat
ggtttaagttttagtgaacttttagataatataatagaactttcccttaaggaatatgaa
ttttga

DBGET integrated database retrieval system