KEGG   Clostridium tetani 12124569: BN906_02065Help
Entry
BN906_02065       CDS       T02905                                 

Gene name
dppD
Definition
(GenBank) dipeptide transport ATP-binding protein dppD
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
ctet  Clostridium tetani 12124569
Pathway
ctet02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ctet00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BN906_02065 (dppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ctet02000]
    BN906_02065 (dppD)
Transporters [BR:ctet02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BN906_02065 (dppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_22 AAA_29 Mg_chelatase PhoH IstB_IS21 AAA_25 AAA_33 SMC_N PIF1
Motif
Other DBs
NCBI-ProteinID: CDI50055
LinkDB All DBs
Position
2000477..2001298
Genome map
AA seq 273 aa AA seqDB search
MNTTQKELLLQVKNLRISFSQYFKGTQKRVIQPISDLHVDINEGEIVAVVGASGSGKSLL
AHAVLGILPSNAICQGQILYRGESLTEERKAQLRGREISFIPQSVNYLDPLMRVGKQVQI
GLEKSIARKSQQELFQQYDLKESDGSLFPYELSGGMLRRVLFATSVRKGVQLVIADEPTP
GIHPQALSEILRQIKRFAKEGAGVMLITHDIMSALEIADRVAVIKDGQTIEISEASAFEG
KGDCLKTEYAKRLWRALPQNDFDLEFQINGGGI
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaataccacacaaaaagaattattactacaggtaaaaaacctaagaattagtttttct
caatactttaaaggaacacagaaacgtgtaattcaacctatatcggatttacatgtagat
attaatgaaggagaaattgtggctgtagtaggagctagtggttcagggaaaagcctcttg
gcacatgctgtattaggaatactacctagcaatgccatttgtcaagggcaaatactttac
cgtggagaatccctgacagaagaacgaaaagcacagttgagagggcgagaaatctctttt
atccctcaatccgtaaattatttagatccgttgatgagggttggaaaacaggttcagatt
ggtctagaaaaaagtatagcaaggaaatcgcaacaagagctgttccaacaatatgaccta
aaggaaagtgacggtagcttatttccctacgagctttctggaggtatgctccgtcgagtt
ttatttgccaccagtgtccgtaaaggggttcaattggtaattgctgatgaaccaacaccc
gggatccatccccaagccctttctgaaattttaaggcaaatcaagcgatttgcaaaagaa
ggtgctggtgtcatgctaattactcacgatattatgtcagctttggagattgcagatcgg
gtggcagtaatcaaagatggtcaaacaatagaaatttctgaagcatcagcttttgaaggc
aaaggcgattgtctgaaaactgaatatgccaaaagattatggagagctttgccacaaaat
gattttgatttggaatttcaaataaatggagggggtatataa

DBGET integrated database retrieval system