KEGG   Chlamydia trachomatis E/11023: E11023_00540Help
Entry
E11023_00540      CDS       T01902                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
ctg00061  Fatty acid biosynthesis
ctg00780  Biotin metabolism
ctg01100  Metabolic pathways
ctg01130  Biosynthesis of antibiotics
ctg01212  Fatty acid metabolism
Module
ctg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ctg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    E11023_00540
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    E11023_00540
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    E11023_00540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ctg01004]
    E11023_00540
Enzymes [BR:ctg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     E11023_00540
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     E11023_00540
Lipid biosynthesis proteins [BR:ctg01004]
 Fatty acid synthase
  Component type
   E11023_00540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ADH20562
LinkDB All DBs
Structure
PDB: 

Position
complement(119500..120396)
Genome map
AA seq 298 aa AA seqDB search
MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFSQSLELGKFNA
SRELSNGELLTFAKIYPMDASFDTPEDIPQEILENKRYKDLSGYTVSEVVEQVKKHFGHI
DILVHSLANSPEIAKPLLDTSRKGYLAALSTSSYSFISLLSHFGPIMNAGASTISLTYLA
SMRAVPGYGGGMNAAKAALESDTKVLAWEAGRRWGVRVNTISAGPLASRAGKAIGFIERM
VDYYQDWAPLPSPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGIGPEMFPKD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaattgatttaacaggaaaaattgctttcatagccggcataggcgatgataac
gggtatggctggggcattgccaaaatgttagcagaagcaggcgcaaccatacttgtgggg
acctgggttcctatctataaaattttctctcaatctttggagttaggaaaattcaatgca
tctcgtgaactctccaatggagaattgctaactttcgctaaaatctatcccatggatgcc
agtttcgacaccccagaagatattcctcaggaaattttggaaaataaacgttacaaagat
ctttctgggtacactgtatccgaagttgtagaacaggtgaaaaaacattttggacacatt
gatattcttgttcactctttagcaaacagtccggaaattgctaaaccattacttgatacc
tctcgtaaaggctatcttgccgccttaagtacatccagctactcctttatcagccttctc
tctcattttggcccaattatgaatgcaggagctagcaccatctctctaacttatcttgct
tccatgcgtgctgttccagggtatggcggaggaatgaacgcagcaaaagctgctttagaa
agtgatacaaaagtactggcttgggaagccggccgacgttggggagtccgagtgaatact
atctcggcagggccattagctagccgtgcaggaaaagctattggatttattgagagaatg
gtggattactaccaagactgggctccactaccttctccaatggaagctgagcaagtaggc
gcagcagcagccttcttagtctctcccctagctagcgcaattacgggagaaactctctat
gtggatcacggagccaatgtgatgggcataggtccagaaatgtttcctaaggattaa

DBGET integrated database retrieval system