KEGG   Chlamydia trachomatis E/11023: E11023_04030Help
Entry
E11023_04030      CDS       T01902                                 

Definition
(GenBank) bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
ctg  Chlamydia trachomatis E/11023
Pathway
ctg00471  D-Glutamine and D-glutamate metabolism
ctg00550  Peptidoglycan biosynthesis
ctg01100  Metabolic pathways
ctg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ctg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    E11023_04030
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    E11023_04030
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    E11023_04030
Enzymes [BR:ctg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     E11023_04030
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     E11023_04030
Peptidoglycan biosynthesis and degradation proteins [BR:ctg01011]
 Precursor biosynthesis
  Amino acid ligase
   E11023_04030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N Mur_ligase Mur_ligase_C Mur_ligase_M CPSase_L_D2 ATP-grasp GARS_A ATP-grasp_4 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ADH21254
LinkDB All DBs
Position
895465..897876
Genome map
AA seq 803 aa AA seqDB search
MMKSLFYHFIGIGGIGMSALAHVLLDRGYSVSGSDLSEGKVVEKLKNKGAEFFLGNQEEH
IPEGAVVVYSSSISKENPEFLSAKSRGNRVVHRAELLAELAQDQISIFVTGSHGKTTVSS
LITAILQEAKKNPSFAIGGLNQEGINGGSGSEYFVAEADESDGSIRCYTPEFSVITNIDD
EHLSNFEGDRELLLASLKDFALKTQQICWYNGDCPRLRSCLQGHTFGLDSSCDLHILSYY
QEGWRLYFTAKYQDVVYADIEVQLVGMHNVLNAAAAMGIALSLGIDEGAIRNAFRGFSGV
QRRLQRKNSSETFLFLEDYAHHPSEISCTLRAVRTAVRQRRILAICQPHRFSRLRECIDS
FPSAFKDADEVLLTEVYSAGEEAEDISYQELAEAISQESIVKCTHIPFHELQRHLEQSIR
VHDVCVSLGAGNIVNLGEKLRDFEPQKLHLGIICGGKSCEHEISVLSAKNIAKHLSKSFY
DVSYFLITREGLWESVSSLETAEDSGKSVFDPEIAQRLEKVDVVLPILHGPYGEDGAMQG
FLETIGKPYTGPAIAFSAIAMNKVFTKRFMSDLGIPVVPYLPLTLAGWKQEQDKWLAHIV
EAFSFPMFVKSSHLGSSIGVFEVHNVIELRDAINEAFMRDNDVFVEENRLGCKEIEVSVL
GDGSGAFVVAGLHERRGSGGFIDYQAKYGLSGKSSAQIVFDTDLSKEIQEQILEAADKIY
RLLLGKGSCRIDFFVDEEGNFWLSEMNPIPGMTETSPFLTSFIRKGWSYEQIVHQLIIDG
LQRFNQRQRLISTSFVDQAFAIQ
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaagcttgttttaccactttattggtattggtgggattggaatgagtgcttta
gcacatgttctgctcgatcgaggatatagcgtatcgggaagtgatctttccgaggggaaa
gtggtagagaagctgaagaataaaggagcggaattctttttagggaatcaagaagaacat
atccctgaaggcgctgtagttgtatacagttcaagtatttctaaagaaaatcctgaattt
ttatcagctaaaagtagagggaaccgtgtagttcatcgagccgaattattagccgagctt
gctcaagatcagatttctatttttgttacaggaagtcatgggaagacaacagtctcttct
ttgatcacagccattttgcaggaagcaaagaaaaatccgtcctttgctataggaggtttg
aatcaagaaggcatcaatggtggttcgggatctgaatattttgttgctgaagcagatgaa
agcgatgggtctattcggtgttatactccagagttttctgttattacgaatatagatgat
gagcatctgtctaattttgaaggagatcgagagcttcttctggcttctttgaaagacttt
gcactcaagactcagcagatctgttggtataatggagattgtcctcgcttgcgttcatgc
ttgcaagggcatacttttggattggactcttcttgtgatctacatattctatcttattat
caagaaggatggagactgtactttacagcaaagtatcaagatgtagtgtatgcagatata
gaagtgcaattggtcggcatgcataacgttttgaatgctgcagcagctatgggaatagct
ctgtcattgggtatagatgaaggtgctataagaaatgctttcagagggttttcaggagtt
caaagacgattacaaagaaagaattcttctgagacctttctctttttagaagattatgca
caccatccttcagagatttcttgtacattacgtgctgttcgtactgctgttagacagaga
cgtattttagctatttgccagcctcatcgtttttctcgattaagagagtgtatagacagc
ttcccatcagcatttaaagatgctgatgaagtcttgttaacagaagtgtacagtgcggga
gaggaggcggaagatatctcgtaccaagagcttgctgaagctattagtcaagagtcgata
gtaaagtgtacgcatattccgtttcatgagttgcagagacatttagagcagtccatccgt
gtacacgatgtgtgtgtatctttaggtgctggtaatattgtgaatttgggagaaaagtta
agagattttgagcctcaaaaactgcacttaggaattatttgtggagggaaatcatgcgaa
cacgagatttccgttctatctgcaaaaaatatagctaaacatctttcaaaatccttttat
gatgtgagttattttttaattactcgagaaggattatgggagagcgtctcttcattagag
actgctgaagactcagggaaatccgtttttgatccagaaatagctcagagactagaaaaa
gtagacgtagtgttgccgatactacatggtccctatggtgaagatggagctatgcaagga
tttctagagactattggcaagccttatacaggtcctgctatcgctttttctgcgatagca
atgaataaagtgtttactaagcgctttatgagtgatttagggattcctgtcgttccttat
ctccctttaacattagcaggatggaagcaagaacaagataagtggttagcacatattgta
gaggctttttcatttcctatgtttgtgaaatcttcgcatttaggatctagtatcggcgtc
ttcgaagttcataatgttatagaattacgagatgccattaatgaagcttttatgcgagat
aacgacgtgtttgtagaagaaaatcgcttaggttgcaaagaaatagaagtttctgtctta
ggagatggatctggtgcgtttgtcgttgctggtctgcatgagcgtcgtgggagtggaggt
tttatagactatcaagcgaagtatgggttaagtggtaagtctagtgcgcagatcgtattt
gatacagatctctctaaagaaatacaggaacaaatactagaagctgcggataaaatttac
cgtttattgctagggaaagggtcgtgtcgtattgacttttttgtagatgaagaaggaaat
ttctggttatctgagatgaaccccattcctggaatgacagaaacgagcccatttcttaca
tctttcattcgtaaagggtggagttatgaacagatagtccatcaacttattattgatggg
ctgcaacgatttaaccaacgccaacgcttgatatcgacgtcttttgtagatcaagcgttc
gctattcagtaa

DBGET integrated database retrieval system