KEGG   Hungateiclostridium thermocellum ATCC 27405: Cthe_0357Help
Entry
Cthe_0357         CDS       T00474                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
cth  Hungateiclostridium thermocellum ATCC 27405
Pathway
cth00500  Starch and sucrose metabolism
cth01100  Metabolic pathways
cth01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cthe_0357
Enzymes [BR:cth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Cthe_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: ABN51595
UniProt: A3DCB6
LinkDB All DBs
Position
complement(448123..450690)
Genome map
AA seq 855 aa AA seqDB search
MYLFGKITVTAVIPDELSKLKDIAYNLWWSWNSEAIDLFREIDLALWEKLGKNPVRFLKE
VSQKKLEAKLKDPDYMQRYKKVVNDFETYMNETDTWFSRNFPDKKDHMVAYFSAEYGLNE
VLPIYSGGLGVLSGDHCKSASDLGIPFTAIGLFYKEGYFSQRINSEGWQETIFTPLNPSN
LPIQPALNDKGEEVIISVELPGRVVYAKVWVVKVGRVNLYLMDTDIEQNSPYDRGLTARL
YGGDQETRIQQEIFLGIGGARVLDALGIKATVYHMNEGHSAFLGLELIRKLVQNHNLPFN
QAKEVVASSVIFTTHTPVPAGNDVFPLEMIDRYFGNYWPSLGINRHEFLDLGLRIGEHHN
FNMTVLALTLAGQKNGVSELHGAVSRNIFKNVWPGIPEDEIPIGHITNGIHTLTWLSPSI
KYLYDKYLDKDWKERLHEKEVWEKVDDIPDEELWKTHCVLKTKMIGYVREKLKEQRAANG
ESIERIKEVDTLLDSNALTIGFARRFATYKRANLIFRDLARIQKLLNNPEKPVQIIFAGK
AHPADGPAHEIIKYINDIAKQEGFNGKVILVENYNMTLARNLVQGVDIWLNNPRRPLEAS
GTSGQKVAINGIINFSVLDGWWCEGYNGKNGWAIGDDTFYDNEYHQDNADSESIYNILEK
QIIPTFFDRNEKGVPEKWVKIMKESIKSIAAQYSTHRMVQDYINKYYIPAMERYDKIKAS
NYQFAANISEWKKKVAHLWPQVQIIAEKTANQLKERNFISGESIPIYATVNLGGLEPSDV
KVQAYYGSIGKNNSIENPVIVDMDVVERNSDGTYLYSANITLYEGGEYGYTFRVIPNHPD
IINPFDLGLIRWIVQ
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgtatctttttggaaaaattaccgtaacagctgtaatacctgacgaactatccaagctc
aaagacatcgcgtacaacttgtggtggtcatggaactctgaagctatcgacctttttaga
gaaatcgaccttgctttgtgggaaaagcttggaaagaatccggtaagattcctcaaggaa
gtaagccagaaaaagcttgaagccaagcttaaagaccctgattatatgcaaagatacaaa
aaagtagtcaatgattttgaaacttacatgaatgaaaccgatacatggttttccaggaac
ttccccgacaaaaaagaccatatggtagcttacttctctgcggaatatggattgaatgaa
gtactccccatatattcaggcgggcttggcgtattatccggtgaccactgcaaatcggca
agtgacctcggaataccctttacagcaatcggcttgttctataaagaaggatatttcagc
cagcgcataaactctgaaggatggcaggaaacgatattcactccgttaaacccttcaaac
cttccaatacaaccggccttaaatgacaaaggtgaagaggtaatcataagtgtggaacta
cccggaagagttgtatacgcaaaagtctgggtggtaaaggtgggccgtgtgaatctgtat
ttaatggacactgatatagagcagaacagtccttatgacagaggtcttaccgccagactc
tacggcggagaccaggaaacaagaatacaacaggaaatcttccttggaataggcggtgca
agagtccttgacgcgttaggcataaaagccaccgtatatcacatgaatgaaggacattcg
gctttccttggccttgagcttatcagaaagctagtacaaaaccataatcttcctttcaat
caggccaaagaagtcgtcgcctcatccgttatattcacaacccatacacctgtacctgct
ggtaacgacgtgttcccgcttgaaatgatagacaggtatttcggaaattactggccgtct
ttgggcataaacagacatgagtttttagatttgggattaagaataggagagcatcacaac
ttcaacatgaccgtccttgccttgacactggcaggacagaaaaacggcgtaagcgagctt
cacggcgcagtatcaagaaacatcttcaaaaatgtatggcctggaatacctgaggacgaa
ataccgatcgggcacatcacaaacggtattcatactcttacatggctttctccaagcatt
aaatatctttacgacaaatatcttgataaagactggaaagaacggcttcatgaaaaagaa
gtctgggagaaggtcgacgacattcccgacgaagagctttggaaaacccattgcgtcctg
aaaacaaaaatgattggatatgtacgcgaaaaacttaaagagcagagagctgcaaacgga
gagtcaatcgaaagaatcaaagaggttgacacactgcttgactccaatgctttaactata
ggatttgcaagaagatttgcaacttataaaagggcaaaccttatattcagagatcttgcc
cgaattcaaaaattgctcaacaacccggaaaaaccggtacagataatatttgccggaaaa
gcccatcctgcagacggacctgctcatgaaatcatcaaatatatcaatgacattgcaaag
caggaaggattcaacggtaaagttattttagtggaaaactacaatatgacacttgcccgc
aatttggttcagggagtggatatttggctcaacaacccgagaagacctcttgaagccagc
ggaaccagcggacaaaaagtggctataaacggaataatcaacttcagcgtactggacggt
tggtggtgcgaaggttacaacggcaaaaacggttgggcaatcggagacgataccttctac
gacaacgaatatcatcaggataatgccgacagtgaatcaatttacaacatactggaaaag
caaattatacctactttctttgacagaaatgaaaaaggtgtacccgaaaagtgggtaaaa
ataatgaaggaatcaataaaatccatcgctgcccaatacagcacgcacagaatggttcag
gattatataaataagtattatattcctgcaatggaaagatatgataagataaaagcaagc
aattatcaatttgcagccaatatctcagaatggaagaagaaggtagcgcatctgtggcct
caggtacagataatagctgaaaaaactgcaaaccaattgaaggaaagaaactttatatcc
ggtgaatccataccgatatacgccactgtcaatcttggaggtcttgaaccttcggacgta
aaggttcaggcctactacggaagcatcggaaaaaacaactctatcgaaaatcctgtaata
gttgacatggatgtagtggaaagaaacagcgacggaacttatctctactctgcaaacatc
actttgtatgaaggcggagagtacggatataccttcagagtgattcctaatcatccggat
attatcaatccgtttgacttgggacttatcagatggattgtacagtaa

DBGET integrated database retrieval system