KEGG   Hungateiclostridium thermocellum ATCC 27405: Cthe_0388Help
Entry
Cthe_0388         CDS       T00474                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cth  Hungateiclostridium thermocellum ATCC 27405
Pathway
cth00040  Pentose and glucuronate interconversions
cth00051  Fructose and mannose metabolism
cth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cthe_0388
   00051 Fructose and mannose metabolism
    Cthe_0388
Enzymes [BR:cth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Cthe_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Shikimate_DH TrkA_N AlaDh_PNT_C NAD_binding_7 FAD_binding_3 2-Hacid_dh_C Pyr_redox_2 NADH_4Fe-4S ThiF Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABN51626
UniProt: A3DCE7
LinkDB All DBs
Position
482647..483681
Genome map
AA seq 344 aa AA seqDB search
MLQSVMVSPGKIEFHEVEKPELKPGQVLIKIMRIGICGSDIHVNHGKHPFTKYPVTQGHE
VSGKIVEVAEDVEHLKVGQKVTIEPQVVCGKCHPCRTGKYNLCEELKVMGFQTVGAGSEY
FAVDAKNVTTVPDHLSYDEAAMIEPLAVTVHAANRVGDVKDKDIVVIGAGPIGILLVQTL
KAKGARKVMVTDVSDYRLELALKCGADFAVNTKKEDFGEAMLRCFGPDKADVIYDCAGNN
TTMEQAIKHSRKGSIIVLVAVFEGMATVDLATLNDKELDLNTTMMYRHEDYVEAIELVEA
GKVKLTPLMSKHFAFRDWEKAYEYIDNNREITMKVLIDVNNDDD
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgttacaatcggttatggtatctcctggaaagattgagttccatgaggtggaaaaaccg
gaactaaaacctggacaagtactaataaagattatgagaattggcatatgtggttcggat
attcatgtaaatcatggaaaacatcctttcacaaagtatccggtaactcaaggacatgaa
gtaagtggaaaaatcgtcgaagttgcagaagatgtggagcatctgaaagttggccagaaa
gtgactatagagcctcaggttgtatgtggtaaatgtcatccgtgccgtacaggaaaatat
aacctctgtgaggaactaaaagttatgggattccagaccgttggcgcaggcagcgaatat
tttgctgttgatgcgaagaatgtaacgactgtccctgaccatctttcttatgacgaggcc
gcgatgattgagcctttggctgttaccgttcatgcggcaaacagagtcggtgatgtgaag
gataaggacattgtagtaataggtgcgggtcctataggaattttgctggttcagaccctg
aaagcaaaaggtgcccgcaaggtaatggttacggatgtaagcgattatcgtttggaattg
gcgctcaagtgtggtgctgattttgcagtcaataccaaaaaagaagatttcggagaagcg
atgcttcgctgttttggacctgataaagcagatgttatatatgattgtgcgggcaacaat
acaacaatggaacaagccataaaacattcccgcaagggaagcataattgttctggttgca
gtatttgaaggtatggcaacagtcgatcttgcaactcttaacgataaggaactggatttg
aatacgacaatgatgtatcggcatgaggactatgtggaagccattgagcttgttgaagcg
ggtaaagtaaaattaacccctctgatgagcaagcattttgcttttagagattgggaaaaa
gcctatgagtatattgacaataatcgtgaaattactatgaaagtcctcattgatgttaat
aacgatgatgattaa

DBGET integrated database retrieval system