KEGG   Hungateiclostridium thermocellum ATCC 27405: Cthe_0574Help
Entry
Cthe_0574         CDS       T00474                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cth  Hungateiclostridium thermocellum ATCC 27405
Brite
KEGG Orthology (KO) [BR:cth00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cth01001]
    Cthe_0574
Enzymes [BR:cth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Cthe_0574
Protein kinases [BR:cth01001]
 Serine/threonine kinases: Other
  Bacterial family
   Cthe_0574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like RIO1 Kdo APH Haspin_kinase PIP49_C
Motif
Other DBs
NCBI-ProteinID: ABN51810
UniProt: A3DCY1
LinkDB All DBs
Position
701454..703565
Genome map
AA seq 703 aa AA seqDB search
MVGQILGNRYELIEKIGGGGMADVYKARCKLLNRFVAIKILKPEFINDEEFLKRFTIEAQ
AAASLSHPNIVSIYDVGQENDIHYIVMEYVNGQTLKEYLDENGALYWKDAVNIAIQICQA
IEHAHKNHVVHRDIKPHNILLTKDGMLKVTDFGIARAVSSSTITMAGNAIGSVHYFSPEQ
ARGGFTDEKSDLYSLGIVLYELLTGRVPFDGESPVAVAIKHIQDEPEEPINIKEDIPTGV
NSIVMRAIQKDQALRYQSASELLNDLYKVLKQPDAQFAKARTTEDSPTVRIPSIKKKELV
LEMDTSGKAGDDAVKKKKKDNKTTVWAVVTSILVIFVLGALMVKGLGPVVYSMFNKPEDF
IVEDYTNQNFYEVKGKLSQYNIEAIEIRKHDDQIPKDRIISQDKAVGERIKPGEFAKIEF
VVSDGPLLVKIPDLRRMEYRQAVIELRQLGLEANVIDEYSDVVSKGVVIRTEPDINAEVK
PGTVVNVYKSLGPEIKYSLVPNLIGKTKSEALNLLVGAKLTMGKIYPEDMTYARDKIVRQ
EPAAGTEVEEGTPVNIYLEDYNPDQKYVTRLIELDNPDNYGENIKFLVNITRSDTKRVET
LYSEVRKKSDFPITISIPVPNGGSTLVRVYLDNKNYMEFTEEFNKRSNETNTGNTANNNG
NSNNNGSGSGTDNINDTNNTDNANNDNERTEESGETNHAEAAG
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggttggtcaaattttaggaaataggtatgaattgattgagaaaatcggcgggggagga
atggccgatgtatataaagcaaggtgtaaattgttaaacaggtttgtggcaattaagatt
ttaaaacccgaatttataaatgatgaggaatttctcaaaaggtttacaatagaggctcag
gccgctgcaagcctgtcacatccgaacattgtctccatatatgacgtaggccaggagaat
gatatacattatattgttatggagtatgtaaacggacagactttaaaggagtaccttgac
gagaatggcgctctttactggaaagatgctgtaaatattgcgattcaaatatgtcaggct
attgaacatgcacacaaaaatcatgttgttcacagagatataaagcctcacaatattttg
cttacaaaagacggaatgctgaaggttaccgatttcggtatagcaagagccgtaagttca
tccactataaccatggcgggaaatgcaataggctcggtgcattatttttcaccggaacag
gcccggggaggatttaccgatgaaaaatcggacctttattcattgggaatagtactgtac
gaacttttgaccggaagagttccctttgacggagaatctcctgtggctgttgcaataaag
catattcaggatgaaccggaagagccaataaatattaaagaggatatacccacgggtgtt
aacagtattgttatgcgggccattcaaaaggatcaggcattaagatatcaatccgcgtcc
gagttgctgaatgatttgtacaaagttttgaaacagcccgacgcccagtttgcaaaagcc
agaaccacggaggacagtcccacggtaagaattccgtcaatcaagaagaaagaacttgtt
ctggagatggacacatcgggaaaagcaggtgatgatgcagtgaaaaagaagaaaaaagac
aacaaaaccactgtatgggcggtggtaacatcaattctggtgattttcgttctgggcgcc
ttgatggtaaagggcttggggcctgttgtttattcaatgttcaacaaaccggaggatttt
attgttgaagattacacaaatcaaaatttctatgaggtaaaaggcaaattgtctcaatac
aatattgaggcaatagagataaggaagcatgatgatcaaataccaaaagatagaataatt
tctcaggataaagccgttggggaaagaataaaacccggtgaatttgcaaagattgagttt
gtggtgagtgacggtccgttgcttgtaaaaataccggacctcagaaggatggaatacagg
caggcggtgatagagctcagacaattgggacttgaagcaaatgtaatcgatgagtacagt
gatgtcgtttcaaaaggtgttgtaatcaggacggaaccggatataaacgcggaggtaaaa
ccgggtacggttgtgaatgtttataagagtttgggtccggagataaaatacagcctggtt
ccgaacttgataggaaagacaaaaagcgaggcattgaaccttttggttggagccaagctt
accatgggtaaaatataccctgaagacatgacttatgccagagataaaatagtaaggcag
gaacctgcagccggaactgaagttgaagaaggaactccggtgaatatataccttgaggat
tataatcctgatcagaaatatgttacccgtctcattgaacttgacaatccggacaattac
ggagaaaatataaagtttttggtaaatataacaagatcggatacaaagagggttgagacc
ttatacagtgaagtacggaaaaaaagtgatttcccgataacgatttccataccggtacca
aacggcggaagtactttggtgagggtatatctcgataataagaactacatggagtttaca
gaagagtttaataaacgcagtaatgaaactaataccggtaatactgccaacaataacggt
aattccaacaataacggtagcggtagcggtaccgataatattaatgataccaataatact
gacaatgccaacaacgataacgaaagaacggaagagtccggtgaaacaaaccatgcagaa
gctgcaggatag

DBGET integrated database retrieval system