KEGG   Hungateiclostridium thermocellum ATCC 27405: Cthe_1031Help
Entry
Cthe_1031         CDS       T00474                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cth  Hungateiclostridium thermocellum ATCC 27405
Pathway
cth00970  Aminoacyl-tRNA biosynthesis
cth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cth00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cthe_1031
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cth03029]
    Cthe_1031
Enzymes [BR:cth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Cthe_1031
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Cthe_1031
Mitochondrial biogenesis [BR:cth03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cthe_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF2489 Lys-AminoMut_A
Motif
Other DBs
NCBI-ProteinID: ABN52263
UniProt: A3DE84
LinkDB All DBs
Position
complement(1233155..1234588)
Genome map
AA seq 477 aa AA seqDB search
MEYEIIVGLEVHVELSTKSKIYCSCTTDFGGEPNTHICPVCTGMPGVLPVLNKKVVEYAV
KTGLATNCSIAKYSKQDRKNYFYPDLPKAYQISQYDLPLCRDGYIDIEVEGRTKRIGITR
IHIEEDAGKLVHDQNETGTLIDYNRCGVPLIEIVTEPDMRSAQEARAFVESLRNILRYID
VSDCKMQEGSLRVDVNLSVRPKGQKEFGTRTEMKNLNSIRSMVRAIESEAKRQIEVIESG
GIIVQETRRWDEHKGVSCSMRTKEEAHDYRYFPEPDLMPIVVDEEWKEEIKRSLPELPDA
RRKRYVNEYGLPGHDAFILTSSKALADFFEEAAGKCNNAKAVSNFILGDVSRILNDKGME
AEDIPFPAEYLAKLVKLVDQGTISTTIAKKVLEIMFEQKKDPQEIVREEGLEVVSDEKAL
AEVVKKVISNNTKLVEDYKKGKDKVFGFLVGQAMKETKGKANPRLLNKILKEELDKI
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggagtatgaaataattgtagggttggaggttcatgttgagctttcaaccaaatcaaaa
atatattgttcatgcaccacggatttcggaggagagccaaatacccacatttgtcctgtc
tgcaccggtatgccgggagtgcttccggttttgaacaaaaaagtggtggaatacgcggta
aaaaccgggcttgccacaaactgcagcattgcaaagtacagcaagcaggacaggaaaaac
tatttttatcccgaccttccaaaagcttatcaaatttcccagtacgaccttcccctatgc
cgggacggatatattgacattgaggtggaaggaaggacaaaaaggattgggattacaagg
atacatattgaggaagatgcgggaaagcttgtacatgatcagaatgaaacgggaacgttg
attgattataaccggtgcggtgtgccgttaattgagattgtcaccgagcctgacatgcgt
tcggcgcaggaagcgagggcttttgtggaaagccttaggaacatactacggtacattgat
gtttccgactgcaaaatgcaggaaggttcattgagagttgacgttaatctttcggtaaga
cctaagggccaaaaggaatttgggacgaggacggaaatgaaaaatttaaattccataagg
tcaatggtaagggcaattgaaagtgaagccaaaagacagattgaggttattgaaagtggc
ggaattattgttcaggaaaccaggagatgggatgaacacaaaggtgtaagctgttcaatg
agaactaaagaggaggcccacgattatcgatattttccggaaccggatcttatgccgata
gtggtggatgaagaatggaaggaagaaataaaaagaagtcttcccgagcttcctgatgca
agaagaaaaaggtatgtaaacgagtatggacttcccggacatgatgctttcattcttaca
agctcaaaggctcttgcagatttttttgaggaggcggcgggaaaatgcaataatgcaaaa
gccgtgagtaattttatactgggggatgtttcgagaatccttaacgacaagggaatggaa
gctgaagacataccttttccggcggaatacctggcaaagttggtgaaattggttgaccag
ggaacaataagcacaaccattgcaaaaaaagtattggagataatgtttgaacaaaaaaag
gatccgcaggagatagtaagggaagaaggacttgaagttgtaagtgatgaaaaagctctt
gccgaggttgttaaaaaggtgatttcaaacaatacaaaattggtggaggattacaaaaaa
ggcaaggacaaagttttcggattccttgtgggacaggctatgaaagagactaaggggaaa
gcaaatccccggcttttaaacaagattttgaaagaagaacttgacaaaatataa

DBGET integrated database retrieval system