KEGG   Hungateiclostridium thermocellum ATCC 27405: Cthe_1602Help
Entry
Cthe_1602         CDS       T00474                                 

Definition
(GenBank) phosphate ABC transporter, ATPase subunit
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
cth  Hungateiclostridium thermocellum ATCC 27405
Pathway
cth02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cth00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Cthe_1602
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cth02000]
    Cthe_1602
Enzymes [BR:cth01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Cthe_1602
Transporters [BR:cth02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Cthe_1602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 RsgA_GTPase AAA_23 AAA_29 AAA_22 Rad17 G-alpha AAA_16 AAA_33 AAA_18 AAA Adeno_IVa2 NB-ARC ATPase_2 AAA_28 AAA_25 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: ABN52828
UniProt: A3DFU9
LinkDB All DBs
Position
complement(1933249..1933998)
Genome map
AA seq 249 aa AA seqDB search
MDKICIKNLDLYYGDFQALKKINLNIKANEITAFIGPSGCGKSTLLKCLNRMNDIVEGCR
ITGKVLLDGEDIYGDIDINLLRKRVGMVFQKPNPFPMSVYDNVAFGPRTHGIKSKIKLDD
IVERSLRQAAIWDELKSRLKKSALELSGGQQQRLCIARALAVQPEVLLMDEPTSALDPIS
TSKIEDLVVELKKDYTIIIVTHNMQQAVRIADSVAFFLNGEVIEYARAEKLFYMPQDKRT
EDYITGRFG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggataagatttgtataaaaaatctggacttatattacggcgattttcaggcgctgaag
aaaatcaacctgaatataaaagcaaatgagattacagcctttatcgggccatcaggctgc
ggaaaatctacgcttttaaaatgcctgaaccgaatgaatgacattgttgaaggttgcagg
ataactggtaaggtcctcctggatggtgaagacatttacggtgatatagatatcaacctg
cttcgaaaacgggtgggaatggttttccaaaagcccaatccttttcctatgagtgtgtat
gataatgtggcattcgggccacgtacacatggcataaaatcaaaaatcaaactggacgat
atagtggaacggtcgctcaggcaggccgcaatatgggatgaattaaagagccgcttaaaa
aagagtgctttggaactctctggcggccagcagcaaaggctctgtattgcgagggcattg
gcggtacagccggaagttttattgatggatgaacctacgtcagctttggatcctatctca
acatccaaaattgaagaccttgttgttgagttaaaaaaagattatactattattatagtt
acccataatatgcaacaggcggtacgcattgcagatagtgtagctttttttttaaatgga
gaagtgatagaatatgcaagagcggagaaactgttctatatgccacaggataaacgcaca
gaggactatataaccgggaggtttgggtaa

DBGET integrated database retrieval system