KEGG   Hungateiclostridium thermocellum ATCC 27405: Cthe_2730Help
Entry
Cthe_2730         CDS       T00474                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cth  Hungateiclostridium thermocellum ATCC 27405
Brite
KEGG Orthology (KO) [BR:cth00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cth03012]
    Cthe_2730
   03029 Mitochondrial biogenesis [BR:cth03029]
    Cthe_2730
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cth04147]
    Cthe_2730
Translation factors [BR:cth03012]
 Eukaryotic Type
  Elongation factors
   Cthe_2730
 Prokaryotic Type
   Cthe_2730
Mitochondrial biogenesis [BR:cth03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Cthe_2730
Exosome [BR:cth04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Cthe_2730
  Exosomal proteins of breast cancer cells
   Cthe_2730
  Exosomal proteins of colorectal cancer cells
   Cthe_2730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABN53929
UniProt: A3DJ00
LinkDB All DBs
Position
3222531..3223733
Genome map
AA seq 400 aa AA seqDB search
MSKAKFERTKPHVNIGTIGHVDHGKTSLTAAITKVLGFQGKANYTSYENIDKAPEERERG
ITISTSHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDEELLELVEMEIRELLNTYEFPGDEIPIIRGSALAALE
STATSVDAPEYQPILKLMEEVDKYIPTPQRDIDKPFAMPVEDVFTITGRGTVATGRVERG
TLKMGDEVEIVGLSDSPKKTVVTGIEMFRKLLDQAVAGDNIGALLRGIQRNEVERGQVLA
KPGSIKPHTYFEAQVYVLTKEEGGRHTPFFNNYRPQFYFRTTDVTGVVELPQGTEMVMPG
DHITMKVKLITPVAMEEGLKFAIREGGRTVGAGNVSKIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagctaaatttgaaagaacaaaaccccacgttaatatcggaacgattggtcac
gttgaccatggtaagacatcattgactgcggctataacaaaagttttaggtttccagggt
aaggcaaactatacttcttatgaaaacatcgacaaagctccggaagaaagagaaagaggt
attacaatatcaacttcacacgttgagtatgaaactgataacagacactatgctcacgtt
gactgccctggtcatgccgactacgttaagaacatgatcacaggtgctgctcagatggac
ggtgctatacttgttgtatcagcagcagacggtccgatgccacagacaagagaacacatt
ttgttggctcgtcaggttggtgtgccatacatagttgttttcttgaacaagtgtgatatg
gtagatgacgaggaacttctcgaattggttgaaatggaaatcagagaactcctgaatact
tacgaattccccggagacgaaattccgataataagaggttcagcacttgctgctcttgaa
tcaacagctacttcagttgacgctccggaatatcaaccgattttgaaactcatggaggaa
gttgacaaatatattccgactcctcagagagatattgacaaaccgtttgctatgcctgtt
gaagatgtattcacaattacaggtcgtggtactgttgctacaggtagagttgaaagagga
actcttaagatgggtgacgaagttgaaattgttggtttgtctgattctccgaagaaaaca
gttgtcaccggtatagaaatgttcagaaagcttcttgatcaggctgttgctggtgacaat
ataggagctctcctgagaggtattcagagaaatgaggtagaaagaggacaggttcttgca
aaacccggttcaatcaaacctcacacttattttgaagcacaggtttacgttttgacaaaa
gaagaaggtggaagacatactcctttcttcaacaactacagacctcagttctatttcaga
actactgacgttacaggagtagttgagcttcctcagggaactgaaatggttatgcccggt
gaccacataaccatgaaagtcaaattgataactcctgtagctatggaagaaggattgaag
ttcgctatccgtgaaggtggtagaactgtaggagcaggaaacgtatccaagataattgaa
taa

DBGET integrated database retrieval system