KEGG   Pseudoclostridium thermosuccinogenes: CDO33_00500Help
Entry
CDO33_00500       CDS       T05300                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cthd  Pseudoclostridium thermosuccinogenes
Pathway
cthd00970  Aminoacyl-tRNA biosynthesis
cthd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CDO33_00500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cthd03029]
    CDO33_00500
Enzymes [BR:cthd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CDO33_00500
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CDO33_00500
Mitochondrial biogenesis [BR:cthd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CDO33_00500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase U83
Motif
Other DBs
NCBI-ProteinID: AUS95062
UniProt: A0A2K2FBT2
LinkDB All DBs
Position
complement(110934..112385)
Genome map
AA seq 483 aa AA seqDB search
MEIHKHNLRSLRSMLDKREISAVELVELYIKRIKEVDHKTNSYITICEEEALLQAKEAQK
LIDSGSSGSLTGIPVSLKDNICTKDIKTTCASKMLEDFYPPYDATVVKKLKACGAVLLGK
TNMDEFAMGGSSQTSYFGGVKNPYDLSRVPGGSSGGAAVSVAAGLAPVSLGSDTGGSIRQ
PASFCGVTGLKPTYGTVSRYGLIAFASSLDQIGPIAKSAEDCGIILDSIAGYDSDDPTTA
HRGAPGSCSKIGMPLNNLKIGIPKEFFGDGINEEVKAAVFAAVKEYEKMGCQVLEVSFPS
LKYAIAAYYLISSAEASSNLSRYDGIKFGYRSKNGESYEELIKNTRAEGFGDEVKRRILL
GTYALSSGYYDDYYKKAAYVRQKIKEDYNRIFNTCDVIITPTAPTTAYMIGEQESNPVKM
YLADICTVTVNIAGLPAISTTCGYDGKGMPIGMSIVGRPFDESTIIGVADAFERNFERQE
VSI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggaaatacataaacataatctgcgttccttaaggagtatgcttgacaagagggaaata
tctgccgttgagcttgttgagctttatataaagagaataaaagaagtggatcacaaaacc
aacagctatatcactatctgtgaagaggaggctcttttgcaggcaaaagaagcccagaag
cttatagattccggttcttccggtagccttacgggaattcccgtgagcctgaaagacaat
atctgcacaaaggatataaagaccacctgtgcctcaaaaatgcttgaggatttttatccg
ccctatgacgcaaccgtggtaaaaaaactcaaagcctgtggggctgtgttgttgggaaaa
accaatatggatgagttcgctatgggaggttcctcccagacttcgtatttcggaggcgtg
aaaaatccttatgatttaagccgtgttccgggaggctcttccggaggtgcagctgtatcg
gtggctgcaggactggcacctgtctccctgggttcggataccggtggttccataaggcag
ccggcttccttttgcggtgtgaccggactcaaaccgacatacgggactgtttcccgttat
ggtctcatagcctttgcatcatccttggaccagatcggaccgattgcaaaaagtgcagag
gattgtggaataatactggacagcattgccggatatgattccgacgatcctacaacagca
catcggggtgcaccaggcagctgcagcaaaatcgggatgccgcttaacaatttaaaaata
ggaattccaaaggaatttttcggagatggaataaacgaagaggtaaaagcagcggttttt
gcagctgtcaaagaatacgaaaaaatgggctgccaggtgttggaggtgtcctttccaagc
cttaaatatgccattgccgcctactacttgatttcatcggcagaggcatcctccaacctg
tccaggtatgatggaataaaattcggttacaggagcaaaaacggcgaatcctatgaggaa
cttataaaaaacacccgggcggaaggcttcggagatgaggttaaacgcaggatactcctg
ggtacctatgccctctccagcggatattatgacgattattataaaaaagctgcctatgtt
cggcagaaaattaaggaggattacaacaggatatttaatacctgcgacgtgataatcact
cctaccgcaccaaccacggcatatatgatcggtgagcaggaaagcaacccggttaagatg
tatcttgcggatatatgcactgttaccgtaaatatcgcaggtcttccggctatatcgacc
acctgcgggtatgatggaaaaggcatgccgataggtatgtccatagtagggcgtcccttt
gatgaatcaactataataggcgtcgccgatgcttttgagagaaattttgaaaggcaggag
gtgtcaatatga

DBGET integrated database retrieval system