KEGG   Pseudoclostridium thermosuccinogenes: CDO33_05005Help
Entry
CDO33_05005       CDS       T05300                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cthd  Pseudoclostridium thermosuccinogenes
Brite
KEGG Orthology (KO) [BR:cthd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cthd01001]
    CDO33_05005
Enzymes [BR:cthd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CDO33_05005
Protein kinases [BR:cthd01001]
 Serine/threonine kinases: Other
  Bacterial family
   CDO33_05005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like Kdo APH Haspin_kinase RIO1 TMEMspv1-c74-12 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AUS95852
UniProt: A0A2K2FHR7
LinkDB All DBs
Position
1149428..1151437
Genome map
AA seq 669 aa AA seqDB search
MESQILGNRYELIEKLGGGGMSVVYKARCSLLNRFVAVKILRPDFTNDEEFVKRFRIEAQ
SAASLSHPNIVPIYDVGNEGDIYYIIMECVDGITLKEYINEKGRLPWEEAVNIAIQICSA
IKHAHKSHIVHRDIKPHNILLTKEGIAKVTDFGIARAVTSSTITMSGNTIGSVHYFSPEQ
ARGGYTDEKSDLYSLGVVLYEMVTGRVPFDGDIPIAVALKHIQEKPKPPIEINTGIPAGL
NDIIMRAMEKDQNLRYQTAHEFLQDLYMIANDPSKRFAGAGAVGDSPTIRVKAVSEEDVM
SAQRTTKKNDAKKGKDNKDRATYWAAGIISVIIIAIFAYIGYRIVMPSLMTEKKDFIVGN
YVGKNIEEVEEELTLAGIYYETKEEYSDTVDKGIIIDQSIDEGKPLNPGNYTPLVLTVSK
GEELIEIQNLRNKERREAEAIIRDLDLVPEIQEQFDEDVPIDRVIKTDPGPDNKVKKGTT
VMIYVSKGPEIKMTKVPKLIGKTMMEAKKLLTDANLKMGKILPEESSNYVDKIVDQFPAA
GEEVKEGTAVDITFEEKKPAEPVAKTLTVPLADPDDYGDVIKVYIEAIPSDTNKAQVVMN
KNVNKEEFPLNIEIPVPEGGYTKIRIYFDDILYNVIDYPYQGVIQPQGHSEDQTQDQEQE
QDQDQEGAH
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtcaaatcctgggaaatagatatgaactgatagaaaaattgggcggaggcggt
atgtccgttgtatacaaggccagatgcagcttgcttaacaggtttgttgctgttaaaatc
ctgaggcctgatttcacaaacgacgaggagtttgtaaaaaggttcagaatagaagcacaa
tcggctgccagcctgtcccatcctaatattgtgccgatatatgatgtcggaaatgaggga
gatatatattacatcatcatggaatgtgtggatggcatcaccctcaaggagtatattaat
gaaaagggaaggctgccctgggaagaagcggtgaacattgccatccagatatgttcagct
attaagcatgcccataaaagtcatattgtccaccgggatataaaacctcataatatcctg
cttacaaaagagggaatagcaaaggttacggatttcggcatagcgagagccgttacttct
tctacaataaccatgtccgggaacaccatcggatcggtgcactatttttcaccggagcag
gccaggggaggatatacggatgaaaaatccgatttgtattccctaggggtggtattatat
gagatggtgacaggaagggtgccctttgatggagacatccctatagctgtagcattgaag
catatccaggaaaagcccaaacctcctatagagataaataccggtattccggccggatta
aatgatattatcatgagagccatggagaaggaccagaaccttagatatcagaccgcgcat
gagttcctgcaggatctatacatgatagctaatgacccaagcaagagatttgcgggtgca
ggcgcagtcggggatagccctacaataagggtaaaggctgttagtgaggaggatgttatg
agcgcccaaaggactaccaaaaagaatgatgccaaaaaaggcaaggacaacaaggatagg
gcaacttattgggctgccggcattatttcggtcatcataatcgccatatttgcttatatt
ggatacaggattgtgatgccttccttgatgacggagaaaaaagattttatagtaggcaat
tatgtgggaaagaatatagaagaagttgaggaagaactgacgctggcaggaatctattat
gagaccaaggaagaatacagcgataccgtagataaaggaataataatagaccagagcata
gatgagggtaagcctctcaatcccgggaattatactccccttgtgcttacggtgagcaag
ggagaagagcttatagaaatacagaacctgagaaacaaggagcgtcgtgaagcggaagcg
ataataagggatcttgacctggtgccggaaatacaggaacagtttgatgaggatgttcct
attgacagagttataaagacagaccccggtccggacaataaagtaaaaaaaggaaccact
gtaatgatttatgtcagtaagggaccggagataaaaatgactaaagtgcctaagcttata
gggaagacgatgatggaagcaaagaagctcctgacggatgccaacctgaagatgggaaag
atactgccggaagagagcagcaattacgtggataaaatagttgatcaattcccggctgca
ggtgaggaagtaaaagaaggtactgctgtggatatcaccttcgaagagaagaaacctgct
gaaccggtggcgaaaacgttgaccgtgcccttagccgatcctgacgattacggtgatgtg
atcaaggtgtacatagaagcgataccttcggatactaataaggcacaggttgttatgaac
aagaatgttaacaaagaggagtttcctctgaatattgagatacctgtaccggagggtggt
tataccaaaatacggatttattttgatgacatcctttataatgttatagattatccatat
cagggtgtaattcagcctcaaggccattcagaagatcagactcaggatcaggaacaggaa
caggatcaggatcaggagggagcacattaa

DBGET integrated database retrieval system