KEGG   Pseudoclostridium thermosuccinogenes: CDO33_05130Help
Entry
CDO33_05130       CDS       T05300                                 

Definition
(GenBank) hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cthd  Pseudoclostridium thermosuccinogenes
Pathway
cthd00040  Pentose and glucuronate interconversions
cthd00051  Fructose and mannose metabolism
cthd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CDO33_05130
   00051 Fructose and mannose metabolism
    CDO33_05130
Enzymes [BR:cthd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CDO33_05130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AUS95875
UniProt: A0A2K2FNP2
LinkDB All DBs
Position
1177476..1178516
Genome map
AA seq 346 aa AA seqDB search
METMKAAVWTEIGKIKVMDVEVPRITRDQVLVKVMSAGLCATDLHVYTGRFRYGEPPHIL
GHEVAGEICQVGDAVEGWNIGDRVVVETSIGCGRCRFCISGQRHLCPEMTEIGFTPNNGA
YAQYMAAPAKNLFRIPDELSDDGAGIMESVVCPVGALYRLGVRFSETVVVFGVGPAGIGF
IQGAKAMGAGKIIAVARNDFRLERARGFGADILINTKKENAEEAIMKETGGIGADLVIDA
TGSPGIIALMPGVTRRAGRMILYGLPEDDASMDYPVKEIIMKQLEVYGAVGNPSVWEPLL
RMAASGVIRLDDMVTHTFPLERIEEAFACLENPDENVLKAVIHPWD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagactatgaaagctgcagtgtggacggagataggtaaaatcaaggtaatggatgtg
gaagtgccgcggattacacgggatcaggtgctcgttaaagtcatgagtgccggattgtgc
gccactgacctccatgtatataccggaaggtttaggtacggtgaaccgccccacattctc
gggcatgaagtggccggagaaatttgtcaggtgggtgatgcagttgagggatggaatatt
ggtgaccgggtagtggtggagacttccataggttgcggtagatgccgcttttgcatctcc
gggcagcggcatctgtgcccggagatgacggaaatcgggtttactcccaacaatggtgct
tacgcccagtatatggcggctccagctaaaaacctgttccggatacccgatgagttgtcc
gacgatggtgctggaattatggaaagcgttgtatgcccggtgggagcattgtaccgcctt
ggggtgcgcttttccgagacagtggtggtgtttggcgttggaccagctggaatcggtttt
attcagggagccaaggcaatgggagcagggaaaattatcgcagtagccaggaatgacttt
cgtcttgagcgggcgaggggatttggtgcggatattttaatcaacacaaaaaaggaaaat
gctgaagaagctataatgaaagagaccggcggcatcggtgccgacctggtaattgatgct
accggatcccccggcattattgcgctgatgcccggtgttaccaggcgggccggacgcatg
atactttatggcctgcctgaggatgatgccagcatggactatcctgttaaggagataata
atgaagcagttggaagtatatggcgcggtgggaaacccgtcagtgtgggagccgcttctt
cgtatggcggcatccggggttatcaggctggacgatatggtgactcacacctttccgctg
gagagaattgaagaagcttttgcatgtcttgagaacccggatgaaaatgttctgaaggct
gtcatccatccatgggattga

DBGET integrated database retrieval system