KEGG   Pseudoclostridium thermosuccinogenes: CDO33_10285Help
Entry
CDO33_10285       CDS       T05300                                 

Definition
(GenBank) hypothetical protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
cthd  Pseudoclostridium thermosuccinogenes
Brite
KEGG Orthology (KO) [BR:cthd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cthd02000]
    CDO33_10285
Transporters [BR:cthd02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    CDO33_10285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 RsgA_GTPase ATPase_2 AAA_22 AAA_16 AAA_23 Rad17 SbcCD_C AAA_24 AAA_29 AAA_14 AAA AAA_28 AAA_30 NACHT NB-ARC AAA_18
Motif
Other DBs
NCBI-ProteinID: AUS96793
UniProt: A0A2K2FC49
LinkDB All DBs
Position
complement(2357947..2358582)
Genome map
AA seq 211 aa AA seqDB search
MKKLELVGVHYAYEKDKPVLKGINAVFEPRKIYAILGPSGCGKTTLLSLIGGLDEPTKGE
IKLDGKSIGENGLSAHRRNNVAFIFQSYNLIDYLTPAENVSLTSKLPPLPILEKVGLSKE
EARRNVQKLSGGQQQRVAIARALASDASLLLADEPTGNLDEETAGEITKLLVESAHELNK
CVIVVTHSQELAKQADVIYRLNRGNIQICKL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactggaactggtaggagtccattacgcttatgagaaagacaaacctgtcctg
aaaggtataaatgcggtttttgaaccgcgcaaaatatatgctatactcggcccttccggc
tgtggtaagacgacattgctatccctaatcggaggattggatgagccgacaaaaggtgaa
atcaagctggatggaaaaagcataggtgaaaacggcctttccgctcaccgacgtaacaat
gttgcttttatttttcaaagctataacttgattgattatcttactcctgccgaaaacgtc
agcctaacttctaaattgcctcccttacccatattggagaaagttgggctgtcaaaggag
gaggcaaggcgcaatgtacagaaactctcgggcggccagcagcagcgcgtagctattgcc
cgtgccctggcatccgatgcctctctcctgcttgcagatgagccaaccggcaacctggat
gaagaaacagcgggagaaattaccaaattgcttgtagaaagtgcccatgagttaaataag
tgtgtgattgtcgtaacgcacagtcaagagcttgcaaaacaagccgatgtgatttacagg
ttgaatcgtggcaatattcaaatctgcaaattatag

DBGET integrated database retrieval system