KEGG   Pseudoclostridium thermosuccinogenes: CDO33_19045Help
Entry
CDO33_19045       CDS       T05300                                 

Definition
(GenBank) hypothetical protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
cthd  Pseudoclostridium thermosuccinogenes
Brite
KEGG Orthology (KO) [BR:cthd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cthd02000]
    CDO33_19045
Transporters [BR:cthd02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    CDO33_19045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_4 ABC2_membrane_2 HlyE
Motif
Other DBs
NCBI-ProteinID: AUS98367
UniProt: A0A2K2FJK4
LinkDB All DBs
Position
4373994..4374746
Genome map
AA seq 250 aa AA seqDB search
MERFKAAFINEIEKMYKRKKAVVIIVISLITIIFGQLVVIGIRSGLGVRGASSTEFPLLV
LSVFANTILPLFTALVTIDTFSGEFSHNTMKIALTKPVSRIKLYSAKVTAIAFFALSNLL
VVMVLSVLTGFLFNTASFTGVGLLRIVVSYLVTLVPILVLAIIITFFSNILKSSGAVFFL
TILLFISLKALGFIFPRYSSLFITSMIDWYNLWIASSIPLMKLLRQLFIMLGYGIMFFTA
GFYLFDKKDL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggtttaaggctgcattcataaatgaaatagaaaaaatgtacaaaaggaaaaaa
gctgtagtgataattgtaatttcgctgataacaatcattttcggccagctggtggttata
ggcataagaagcggccttggcgtacggggagcaagcagcaccgagtttcctcttttggtg
ctgtcggtgttcgccaatacaatacttccgctctttaccgccctggtgaccatagataca
ttctcaggcgaattttcccacaatacgatgaaaatcgcgttgacaaagccggtaagcagg
attaaattgtattcggccaaagttaccgccatagccttttttgcgctgtcaaatctcctg
gtggtgatggtcctgtccgtattgacaggttttctgtttaatacggcatcgtttaccgga
gttggcctccttagaattgtagtttcatatctggttacgctggttccgatattggttctg
gctataatcataacctttttctcaaatattttgaaaagcagcggagcagtttttttcctc
acgattttgctgttcatatccttaaaagccctgggatttattttccccaggtattccagc
ttgttcatcacctcgatgatcgactggtacaacctctggattgcgagcagcataccgctt
atgaaacttttgaggcagttatttataatgctgggatatggtataatgttttttacagca
ggcttctacctgtttgataaaaaggatctttaa

DBGET integrated database retrieval system