KEGG   Chroococcidiopsis thermalis: Chro_0344Help
Entry
Chro_0344         CDS       T02360                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
cthe  Chroococcidiopsis thermalis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AFY85896
UniProt: K9TUP7
LinkDB All DBs
Position
376320..377198
Genome map
AA seq 292 aa AA seqDB search
MSETLPISSKYHILKLVGQGQFGRVYCAIDKKNGKTVALKELDQQKFPTKKFLRELHFLS
SLQHPNIISFQGIEHIKNARFLVMDYCEAGTLRNFMQSDDFNLIHGLKFITDILAGLGHA
HTRGVVHCDIKPENILISIGSTSYLARISDFGLARVCQEISTDKIICTGSPAYMAPERFY
GKSSPASDLYAVGVMLYELVLGFRPFSGMPGELMTAHMNQAVEIPSAVPLLLRSTISTAM
QKFPNKRFPSAAEMMKSVQLAIEVEKVTYGNIPPLNIPSNIPSFSYLNSTQA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaactttaccaatttcctccaaatatcatattttaaagctagttggacaaggg
caattcggacgagtctactgtgctattgataaaaaaaatggtaaaactgtagcacttaaa
gaactcgaccaacaaaagtttcccacgaaaaagtttttacgagaattacatttcttatct
agcttgcagcatccaaatatcatttctttccaaggtatagagcatataaaaaatgcaaga
tttctggttatggactattgcgaagccggaactttgcgtaatttcatgcaaagcgatgac
tttaatctcattcacggtttgaaatttattacagatattcttgctggactgggacacgca
cacactcgtggtgtcgttcactgcgatattaagccagaaaatattttaattagtataggt
tctactagctacttagctcggatttctgattttggtttagcaagagtttgtcaagaaatt
tctacagataaaattatctgtactggttctcctgcatatatggctccagaaagattttat
ggtaaatcttctccagcgtcagatctttatgcagttggagtcatgctgtacgagttggtt
ttgggttttcgtcctttttcaggaatgccaggagaattgatgacagctcacatgaatcaa
gctgtggaaattcctagcgctgttccgctcttactacgttctacaatctccactgccatg
caaaaattccctaacaagcggtttccatcagcagctgagatgatgaagtcagtgcaatta
gccatagaagtagaaaaagtaacgtacggtaatattcctcctctaaatataccttctaat
attccttcattctcttacctaaatagtacgcaagcctag

DBGET integrated database retrieval system