KEGG   Chroococcidiopsis thermalis: Chro_1139Help
Entry
Chro_1139         CDS       T02360                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00620  Pyruvate metabolism
cthe00680  Methane metabolism
cthe00710  Carbon fixation in photosynthetic organisms
cthe01100  Metabolic pathways
cthe01120  Microbial metabolism in diverse environments
cthe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cthe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Chro_1139
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Chro_1139
   00680 Methane metabolism
    Chro_1139
Enzymes [BR:cthe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Chro_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AFY86668
UniProt: K9TW89
LinkDB All DBs
Position
complement(1268551..1271700)
Genome map
AA seq 1049 aa AA seqDB search
MTSLLHSHDEALTISTSPFDLFLRQRLQTVEELWESVLKQECGQELVNLLAQLRDLCSSE
GQAIDEQIAEVVQLISQLELNEAIRAARAFALYFQLINIVEQHYEQRQQLSISRALHQKA
AKQLHQTPQPTSTINGHQTADVNRDPGVELLEKNWHATQQQQKQGTFHTLFPHLRQMNVP
PQHIQRLIDQLDVRLVFTAHPTEIVRSTIRDKQRRLAKLLQQLDRIEESTGSIEGANPWE
AEALREQLTEEIRLWWRTDELHQFKPAVLDEVEYALHYFKEVLFEQIPLLNHRFKHALAS
AFPRLRPPSNNFCKFGSWVGSDRDGNPSVTPQVTWQTACYQRQLVLEKYIHSVKRLTNLL
SISLHWSDVLPDLLESLEQDRLQMNEVYEALALRYRQEPYRLKLAYILKRLENTFERNAR
LYNKNLRKQEIQEENVTTAVYKSGLDFLAELRLIQRNLSETGLNCRELDSLICQVEIYDF
NLAHLDIRQESSRHAHAFNEVLEYLQILPQSYNELSEAERVKWLSEELQTRRPLIPAELP
FSEKTNEAIETLRVVRLLQQEFGVQVCQSYIISMSRDLSDLLEVLLLAKEAGLYDPATGI
GTIQVVPLFETVEDLQRAPSIMQQLFDLTFYRALLAGGYEAIKRESGVGSRESVGQGDKE
TRRQGNNSSHQPLATSHSPLTAHLQEVMLGYSDSNKDSGFLSSNWEIHKAQKALQQVAEQ
HGVDLRIFHGRGGSVGRGGGPAYEAILAQPGHSINGRIKITEQGEVLASKYSLPELALYN
LETISTAVIQASLLRTGFDNIQPWNEILEELAARSRQHYRALIYEQPDFIDFFHQVTPID
EISQLQISSRPARRQGGKKDLSGLRAIPWVFSWTQSRFLLPAWYGVGAALQEFLNEEPEQ
HLKLLRYFYMKWPFFKMAISKVEMTLAKVDMQIAHHYVKELSKPQDLERFERLFEQILQE
FHLTTDLVLSITGHKRLLDGDPVLQQSVQLRSATIVPLGFLQVSLLKRLRQYSNPSTTGI
IDSRHSKGELLRGALLTINGIAAGMRNTG
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgctcctccactcccatgatgaagctttgactatcagcacctctccctttgat
ttgtttttgaggcaacgcctgcaaacagtagaggagttgtgggagtctgttctgaaacaa
gaatgcggtcaagaattagtaaatctcttggcgcaattacgcgatttatgctcgtcagaa
ggacaagcgatcgacgagcaaatagcggaagtcgtacaattaatctctcagttagagttg
aacgaagcaattcgcgctgcgcgtgcctttgcactctatttccagttgattaacattgtc
gagcagcactacgagcaacgccaacaactgagtatcagtcgcgctttgcatcaaaaagca
gctaagcagctacatcaaacgccacaacccacctctacaattaacggacatcaaacagca
gatgtaaatcgagatcctggcgtagagctgttagaaaaaaactggcacgctacccagcag
cagcaaaaacaagggactttccacaccttgtttccccatctacggcagatgaacgtaccg
ccgcaacacattcaacggttgatcgaccaattagatgtcagattagtctttacggcgcac
cccactgagatcgtgcgctctacaattcgggacaagcaaagacgcttagccaagctactg
caacagctcgatcggattgaggaaagtacgggcagtattgaaggtgctaatccttgggaa
gcagaagccctgcgggaacagctcacagaagaaattcgcctctggtggcgcactgacgag
ttacaccaatttaagccagcagtgttagatgaggtagagtacgccctgcactacttcaaa
gaagttctgttcgagcaaattcccttgctgaatcacagatttaaacacgctctggcatct
gcctttccccgcttgcgtccgcctagtaataacttttgtaaatttggttcctgggtagga
tcggatcgggatggcaacccctcagtgacaccccaagttacgtggcaaacggcttgctat
caacgccagttggtgttggaaaaatacattcattcagtcaagcgactgacaaatttattg
agcatatcgctgcactggagcgatgtcctgccagatttattagaatctctggagcaggat
cggttgcagatgaacgaagtgtatgaagcacttgccctgcggtatcgtcaagaaccctat
cggctcaagcttgcctacattttgaagcgactagaaaatacattcgagcgtaacgcgcgc
ctgtacaacaagaatctgcgcaagcaagaaattcaagaagagaacgtcaccacggcagtc
tataaatctgggcttgactttctcgcggaattacgactaattcaacgcaacttgtcagaa
acaggcttaaactgccgagaacttgatagcctgatttgtcaagtagaaatttatgacttt
aacctagctcacctcgatattcgccaagaatcttctcgccacgcccatgctttcaatgaa
gtgttggaatatctacaaattctgcctcagtcatataacgaattgtcagaagcagaaaga
gtcaagtggttgtcggaagaattgcagactcgtcgtccgttgattcccgccgaactacct
tttagtgaaaaaaccaacgaagcgatcgaaactttgcgcgtcgtgcgtttgttacagcaa
gagtttggcgtgcaggtttgccagagttacattatcagcatgagccgcgatctgagcgat
ttgctagaggtgctgttactagctaaagaagctggactctacgatccagcaacaggaatc
gggacgatccaagtcgtacctctatttgagacggtagaggacttgcaacgcgcccccagc
atcatgcaacagctattcgatctgacgttttatcgcgctttgttggcgggagggtatgaa
gcgataaaacgggagtcgggagtcgggagtcgggagtcggtgggacaaggggacaaggag
acaagaagacaaggaaacaattctagtcaccagccactagccactagccactctccactt
actgctcacttacaagaggtgatgttgggttactcagatagcaacaaggattctgggttt
ctcagcagcaattgggaaattcacaaagcgcaaaaagcactccaacaagttgccgaacag
catggagtcgatttgagaatttttcacggacgcggcggctcggtaggacgtggtggtggt
cctgcatacgaggcaattttggctcaacccggacatagtattaatggcagaattaaaatt
accgaacaaggtgaagttttagcttctaaatactcgctgccagagttggcgctttacaat
ttggaaacaatttcgactgccgtgattcaggctagcttgttacgcacgggctttgataat
attcaaccatggaatgaaatattagaagagttagcagcgcgatcgcggcaacattatcgc
gccctgatctacgagcaaccagatttcattgactttttccaccaagtgactccgattgac
gagatcagccaactccaaatcagctctcgccccgcacgacgacaaggtggaaaaaaagat
ttaagtggtttgcgggcaattccttgggtgtttagttggacgcaaagccgttttctccta
cctgcttggtatggtgtcggcgcagctttgcaggaatttttaaacgaggaaccagagcaa
cacctcaaattgttacgttatttctacatgaagtggcccttcttcaaaatggcaatttct
aaagtagagatgacgctggcaaaagtagacatgcaaatcgctcatcactacgtcaaggag
ttatcgaaaccccaagacttagaacgatttgagcggttattcgagcaaattttgcaagag
tttcacctcacaactgacttagtactgagtattacaggtcataaacgcctgctcgacggc
gatccagttttacagcagtccgtgcagttgcggagtgcgacgattgtaccgttaggattt
ttgcaggtttcattgctgaagcgactgcggcaatacagcaacccgagtacgacaggcatc
atcgattctcgccatagcaaaggtgaattgttgcgcggtgcattgttaactatcaatgga
atcgcggctgggatgaggaatactggttga

DBGET integrated database retrieval system