KEGG   Chroococcidiopsis thermalis: Chro_1853Help
Entry
Chro_1853         CDS       T02360                                 

Definition
(GenBank) monosaccharide ABC transporter ATP-binding protein, CUT2 family
  KO
K10441  ribose transport system ATP-binding protein [EC:7.5.2.7]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cthe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Chro_1853
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cthe02000]
    Chro_1853
Enzymes [BR:cthe01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.7  ABC-type D-ribose transporter
     Chro_1853
Transporters [BR:cthe02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    Chro_1853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 RsgA_GTPase AAA_30 AAA TsaE Zeta_toxin AAA_29 AAA_16 AAA_23 PvlArgDC Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: AFY87364
UniProt: K9TZF4
LinkDB All DBs
Position
complement(2057787..2059319)
Genome map
AA seq 510 aa AA seqDB search
MTTTTSPPIPRLEMRGITKKFHGVTALENVNLTVYPGEIHALMGENGAGKSTLMKILAGA
YETDAGEIRINGDPVKISDPSAARQAGIALIYQELNLAPNLTVAENIFMGSELTKGYFLD
RDRMNQEAAAVLNSLGASFQPEDTVSRLSIAEQQQVEIARALKDNSRILIMDEPTAALSD
RETEQLFELIRKLRDNGIAIIYISHRMEEIYALADRISVLRDGEYVGSLERQEISSERLV
QMMVGRPLQDLFEKQPGKTIGSVVLEVKNISDGGKIQPASLTLHAGEIVGLAGLVGAGRT
ELCRLIFGADPKTSGEVILDGKHLNINQPSDAIAAGIGYVPEDRKEQGLFLEMSCRKNIA
INLLKREAKVGTISPLRINQIASAAVDNFNIRLAELGIRALDLSGGNQQKLLLARWLAIK
PKVLMLDEPTRGVDIGAKSEIYRIISDLAAQGVAILMVSSELPEIIGMSDRVLVMREGRL
VGELNSTNGEKITQEKIMTYATGAIEGEKL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacaacatcccctcccatccctcggttagaaatgcgaggcatcaccaagaaa
tttcacggtgtaactgccttagagaatgtcaatttgactgtttatccaggtgaaattcac
gctctgatgggcgagaatggcgcgggtaaaagtacgttgatgaaaattctggctggggca
tacgaaacagatgcaggcgaaattcgcattaacggcgacccagtaaaaatttccgatcct
agtgctgctaggcaagccggaattgccctgatttatcaagaactgaatctcgcccccaac
ttgactgtagctgaaaacattttcatgggtagcgagttaactaagggatatttcctcgat
cgcgatcgcatgaatcaggaagcagcagcagtcctcaacagtctgggagcgagttttcag
ccagaagacacggtgtctcgcctctcgattgccgaacagcaacaagtcgagattgcgcgg
gcgctcaaggacaatagccgcatcctaattatggatgagccaaccgcagcgctttcagac
cgcgagacagaacaactatttgagttaattcgcaagctgcgagacaacggcatcgccatt
atctacatcagtcatcgcatggaagaaatttacgcgcttgccgatcgcattagcgttttg
cgagatggcgagtacgtaggcagtttagaacgccaggagatctctagcgagcgcctggta
caaatgatggtaggcagacctttgcaagatttgtttgaaaaacagcccggaaaaaccatc
ggttcagtcgtactagaggtaaaaaacattagcgatggtggcaaaattcagcctgcaagt
ttaacactacacgcaggagaaattgtcggcttggcaggactggtaggtgcaggacgtacg
gaattatgtcggttaatcttcggtgctgaccccaagacaagtggtgaagtgattttagat
ggtaaacatctcaacatcaatcaacccagcgatgcgatcgccgctggtattggttacgtg
ccagaagaccgcaaagaacagggcttatttctcgaaatgagctgccgcaagaatattgca
attaacctgctcaaacgggaagcgaaagtaggcacgatcagcccattacgaattaaccaa
attgcctcagccgcagtcgataactttaatattcggctagcagaactaggcattagagcc
ttagatttgtctggtggcaaccaacagaaactgctgctagcaagatggttggcaattaag
cctaaagttttgatgttagacgaacccacaaggggtgtagatattggcgcaaaaagcgaa
atttatcgcatcattagcgacttagcagcccaaggagttgcaattctaatggtttcgagc
gaactacctgaaattatcgggatgagcgatcgcgttttggtgatgcgagaagggcgttta
gttggcgaactaaacagtaccaacggcgagaaaattacgcaagaaaagattatgacttac
gccaccggagcaattgagggagaaaaattatga

DBGET integrated database retrieval system