KEGG   Chroococcidiopsis thermalis: Chro_1978Help
Entry
Chro_1978         CDS       T02360                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00010  Glycolysis / Gluconeogenesis
cthe00020  Citrate cycle (TCA cycle)
cthe00620  Pyruvate metabolism
cthe01100  Metabolic pathways
cthe01110  Biosynthesis of secondary metabolites
cthe01120  Microbial metabolism in diverse environments
cthe01130  Biosynthesis of antibiotics
cthe01200  Carbon metabolism
Module
cthe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chro_1978
   00020 Citrate cycle (TCA cycle)
    Chro_1978
   00620 Pyruvate metabolism
    Chro_1978
Enzymes [BR:cthe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Chro_1978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: AFY87488
UniProt: K9TYN0
LinkDB All DBs
Position
2211305..2212633
Genome map
AA seq 442 aa AA seqDB search
MTLHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVLVVESDKADMDVESFYEGYFATI
LVPAGEAAPVGATIALIAETEAEIAIAQQQAQSGNQTTSAPAATTSPGQTADVKNTAPTP
TPVSAVATDSQAESQNGASRSDGRVIASPRARKLAKDLKVDLNTLKGSGPHGRIVAEDVE
AFAGKTTAPSVPAKPQVTTPSAAPAPQPVATPTPVSTVAGSVQPLTTLQNAVVRNMVASL
QAPDFRVGYTITTDALDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLVNASYSEQGIVYH
PNINIAVAVAMDDGGLITPVLQNADKLDIYSLSRNWKSLVDRARAKQLQPEEYNSGTFTL
SNLGMFGVDRFDAILPPGQGAILAIGASRPQVVATADGMLGVRQQMQVNMTSDHRIIYGA
HAAAFLQDLAKLIETNAQSLTM
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgactctacacgaagttttcatgcccgctctcagttctacaatgaccgaaggcaaaatt
gtctcttgggtcaaatcgcctggtgacaaggtagaaaaaggcgaaacagtcctagtagtt
gagtccgataaggcagacatggatgtggaatccttttacgaaggatattttgccaccatc
ctcgtccccgctggagaagctgcccctgtaggagctacaatcgccttaattgccgagaca
gaagcagaaattgcgatcgcgcaacaacaagcgcagtcgggaaatcaaacaacttcagca
cctgctgctacaacttccccagggcagacagcagatgtaaaaaatacagcccctactcca
actccagtcagtgcagttgcaactgactctcaagctgagtctcaaaatggtgcaagtcgt
agtgatgggcgggttatcgcttcaccccgcgctcgcaagttagcgaaggatttaaaagtc
gatctaaatactcttaaaggtagcggtcctcacggtcggattgtagcggaggatgtggaa
gcttttgctggcaagactacagccccatcggttccagcaaaacctcaagtaacgactcct
agtgcagccccagcacctcaaccagttgctacccctacccctgtaagtaccgttgctggc
tccgtgcagcccctcaccacattacaaaacgctgtggtacggaatatggttgctagcctg
caagcacctgattttcgggtgggttataccatcactaccgatgcactagataagctttac
aagcaaattaagtccaagggcgtaacaatgacagctttactagctaaagctgtagcggtg
acactacaaaagcatccattagtgaatgctagttactcagaacagggaattgtctatcac
cctaacattaatattgctgtggctgtagcaatggatgacggtggcttaattacgccagtg
ctgcaaaacgccgacaaattagatatctattcactttctcgcaattggaagtctttagta
gaccgtgccagagccaagcagttacaaccagaggaatataacagcggcacgtttacgctg
tcaaatttagggatgtttggcgtagaccgtttcgatgctattttacccccaggacaagga
gcaattttagcgatcggtgcgtcgcgtccccaggttgtagctacagctgatggaatgttg
ggcgtgcgccagcaaatgcaggtcaatatgaccagcgaccaccggattatttacggcgct
catgcagcagcgttcttgcaagatttggcaaagttaattgaaacgaacgctcagtctttg
acaatgtag

DBGET integrated database retrieval system