KEGG   Chroococcidiopsis thermalis: Chro_5041Help
Entry
Chro_5041         CDS       T02360                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00500  Starch and sucrose metabolism
cthe01100  Metabolic pathways
cthe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cthe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Chro_5041
Enzymes [BR:cthe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Chro_5041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase RFC1
Motif
Other DBs
NCBI-ProteinID: AFY90417
UniProt: K9U5P7
LinkDB All DBs
Position
complement(5661134..5663824)
Genome map
AA seq 896 aa AA seqDB search
MQPIRTFNVSPRLSPRLEPLRRLAYNLHWDWNVESKDLFRRLDPDLWESSHHNPVLMLGN
ISQARLQEVEEDEGFLAQMDRAARQLDDYLQERTWYDKQRGQKTGDGSLASQHTLHESTR
YAKECYAYFSAEFGLVDCLPIYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYL
NADGWQQERYPINDFYNMPLHLERNPDGSEIRVAVDYPGRTVYARVWRVQVGMVPLYMLD
TNIEPNGAYDHNITDQLYGGDLDMRIHQEIMLGIGGVRMLKALGYNVTAYHMNEGHSAFL
ALERIRVLMQGEGLSFTEARQVVAASNLFTTHTPVPAGIDLFPADKMLYYLGHYADAFGL
GRDEFLGLGRENTGDLSAPFSMAVLALKMATFANGVAQLHGVVSREMFQGLWHGVPEEEV
PITAITNGVHARSCVAKSTQELYDRYLGPNWSSAPSENQLWERMDAIPDEELWRNHERCR
LDMIVYVREHLVKHLRDRGASPAEIAEAQEVLDPYALTIGFARRFATYKRATLWMRDFKR
IEKILTNKDRKVQFVFAGKAHPKDIPGKELIREINRFIREHGLEKQVVFVPNYDMHISRL
LVAGCDVWLNNPRRPREASGTSGMKAAMNGLLNLSVLDGWWDEADYVRTGWAIGHGEIYD
DPNFQDEVEANALYDLIEQEVARLFYDRDTDNLPRHWIAKMKDAIRINCPFFNTSRMVGE
YALRGYFPASDRYSTLTADKFVPAKELARWKADLTEHWNYIKVVEIDIAEPAEIQVNQNI
AVKARIDLATLSPDSVQVELYKGNVDASGEIVNGVPITMQFQGTDPQGMSIYTVEINYTT
SGLQGLSLRVLPKHKYLSNPYETRLILWAEDSSAVKVSSLDGQGSRDNNVPAGAIA
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaattcgcacgtttaatgtctctcctcgcctatcgccgcgcctcgaacctctc
cggcgactggcttacaacttacattgggattggaacgttgaaagcaaagatttatttcgg
cgcttagaccccgatttgtgggaatcgagccaccataaccctgtattaatgttgggtaac
attagtcaagcgcggttgcaagaagtggaggaggatgaaggcttcttggcgcaaatggat
agggctgcccgtcagctagatgactacttgcaagaacgcacctggtatgataagcaacgc
ggacagaagacgggagacggtagcctggcatcgcagcacacgctccacgaatctacgcgc
tatgccaaagagtgttacgcttatttttcggcagaatttggtttagtagattgtttgccc
atctactccggtggcttaggggtactagcaggagatcatctcaaatctgcgagtgacttg
ggtttaccgttggtgggtgtgggcttactctatcagcaaggctattttgcccaatatctc
aacgctgatggctggcaacaagaacgctatcccatcaatgacttttataatatgccgctg
cacttagagcgcaatcctgacggctctgagatccgcgttgcagtggactaccctggaaga
accgtctatgcgagagtctggcgcgtccaagtagggatggttccgctatacatgctcgat
accaacatcgaaccgaatggtgcatacgaccataacattaccgaccaactctacggtggc
gacctcgatatgcgcatccaccaagaaattatgttgggaatcggtggcgtgcggatgcta
aaggcgttgggatataacgtcacggcataccacatgaacgaaggacactcggcattcttg
gcattagaacgcatccgcgtgttgatgcagggtgaaggtttgagttttactgaagccaga
caagtcgtagcagcaagtaacctatttaccacccataccccggttcccgcaggaatcgat
ttgttccccgcagacaaaatgttgtattacctgggacattatgccgatgcattcgggttg
ggacgcgatgagtttttgggcttgggacgcgaaaatactggcgatctgagcgcgcctttt
agtatggcagtgttagcgctaaaaatggcgacttttgctaacggggtagcccagttacac
ggtgtcgtgtcacgcgagatgtttcaaggattgtggcacggtgttccagaagaagaagtg
ccaattacagccatcactaacggggttcacgcccgtagttgtgttgctaagtcaacccag
gaattatacgatcgctatttgggtccgaattggtcttcagcccccagcgagaatcagtta
tgggaacggatggatgcaattcccgatgaggagttgtggcgcaaccacgaacgctgtcgt
ctggacatgatcgtgtacgtccgggagcatttagtcaagcatttgcgcgatcgcggtgct
tctcctgctgaaattgccgaagctcaagaagttctagacccctatgctttaaccatcggc
tttgcacggcgctttgctacctacaagcgcgcaactttatggatgcgcgactttaagcgg
atcgagaaaattcttaccaataaagaccgcaaagtacaatttgtctttgcaggtaaggca
caccctaaagatattccaggcaaagaactgattcgcgagatcaaccgctttattcgcgaa
catgggttagagaagcaagttgtcttcgtcccgaattatgatatgcatatttcgcggttg
ttagttgctggctgcgacgtttggctcaacaatccccgccgtccccgcgaggcttccggt
acgagtggaatgaaagcagcgatgaatggactactcaacttgagtgtcttagatggatgg
tgggatgaagccgattacgtccgcactggttgggcgattggacatggagaaatttacgac
gatcccaatttccaagatgaagtcgaagcaaatgccttgtacgatttaatcgagcaggaa
gttgccagactattctacgatcgcgatactgacaatctgccccgccactggattgccaaa
atgaaggatgcaattcggattaactgtccgtttttcaatacttcccggatggtaggcgag
tacgccttacggggttatttcccagctagcgatcgctactctaccttaactgccgataaa
tttgtcccagcaaaagaattggctcgttggaaagccgatttaaccgaacactggaactac
attaaagttgtcgagatcgatattgccgaaccagcagaaattcaagtgaatcaaaatatt
gctgtcaaagccagaatcgatcttgccacattgtcccctgatagcgtgcaggtagaactg
tataaaggtaacgttgatgctagtggggaaattgtcaacggcgtaccaattacgatgcag
tttcaaggtacagatccacaggggatgagtatctatacggttgaaattaactacaccact
tctggcttacaaggattgtcattacgggtattgccaaaacacaaatatctgtccaatccc
tacgagacgcgactaattctctgggcggaggactctagcgccgtcaaggttagcagcttg
gacgggcaagggagcagggacaacaatgtacccgctggtgcgatcgcctaa

DBGET integrated database retrieval system