KEGG   Chroococcidiopsis thermalis: Chro_5499Help
Entry
Chro_5499         CDS       T02360                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00010  Glycolysis / Gluconeogenesis
cthe00053  Ascorbate and aldarate metabolism
cthe00071  Fatty acid degradation
cthe00280  Valine, leucine and isoleucine degradation
cthe00310  Lysine degradation
cthe00330  Arginine and proline metabolism
cthe00340  Histidine metabolism
cthe00380  Tryptophan metabolism
cthe00410  beta-Alanine metabolism
cthe00561  Glycerolipid metabolism
cthe00620  Pyruvate metabolism
cthe00625  Chloroalkane and chloroalkene degradation
cthe01100  Metabolic pathways
cthe01110  Biosynthesis of secondary metabolites
cthe01120  Microbial metabolism in diverse environments
cthe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chro_5499
   00053 Ascorbate and aldarate metabolism
    Chro_5499
   00620 Pyruvate metabolism
    Chro_5499
  Lipid metabolism
   00071 Fatty acid degradation
    Chro_5499
   00561 Glycerolipid metabolism
    Chro_5499
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Chro_5499
   00310 Lysine degradation
    Chro_5499
   00330 Arginine and proline metabolism
    Chro_5499
   00340 Histidine metabolism
    Chro_5499
   00380 Tryptophan metabolism
    Chro_5499
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Chro_5499
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Chro_5499
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Chro_5499
Enzymes [BR:cthe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Chro_5499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AFY90859
UniProt: K9U9E1
LinkDB All DBs
Position
complement(6190183..6191550)
Genome map
AA seq 455 aa AA seqDB search
MNYSELLRQQREFFQTGKTRSIDFRLAQLKILKQAIVEYEIAINEALQADLHKPVVEIYL
TEITVVKKEIDYAIKHLKSWIKPHKAAVPLEQLPGAGKIYPEPLGIVLIISPWNYPLQLA
ITPLVGAIAAGNCTIIKPSEIATHAAAVLAKMLQKYFDSTYISVVEGGVETSQKLLTEKF
DHIFFTGGTNVGRIVMEAAAKHLTPVVLELGGKSPCIVDTDINLEYAAKRITWGKFINAG
QSCIAPDYLLVPEAIKQQFIEKIQKCIAEFYGAQPANSPDYGRIIDRKQFDRLVALLADG
KIVFGGETDAESRYIAPTVIELASLDVPAMQSEIFGPILPVVTYQHISEAIAIVNQGSKP
LALYLFSRDRNLQKRVLAETSSGSACINDTVLQFVVPTLPFGGVGSSGMGKYHGKASFDI
FSHYKSVLYRSLAIEINLRYPPYRGKLPLLKRILG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaattactccgagctgctacgccaacaaagagaattttttcaaactggtaaaacgcga
tcgatagactttcggcttgcccagctaaaaatcctcaaacaggcgatagttgagtacgaa
attgctattaacgaggcattacaagcagatctccataaaccagttgttgaaatatactta
acagaaattaccgtagtcaagaaagagatcgactacgccatcaaacatctaaaaagttgg
ataaaaccccataaagctgccgttccgcttgaacaactacctggtgctggcaaaatctat
ccagaaccgctaggaattgttttaattattagtccgtggaattatccattgcagttagct
attactccactcgtgggggcgatcgcagcgggcaactgtacgattattaaaccatcagaa
atcgctactcacgctgctgcggtcttagctaaaatgttacaaaaatattttgattccaca
tatatttcagtggtggaaggcggagtcgagactagccaaaaactattaacagaaaaattt
gaccatatattttttactggtggtacaaacgtaggtagaattgtgatggaagcggcagcc
aagcacttaactccagttgtcttagaactaggtggtaaaagtccttgtattgtcgatact
gacatcaatcttgagtatgctgccaagcgaattacttggggaaaatttattaatgctgga
caaagttgtattgcccccgactatcttttagtcccggaagcaattaaacaacaatttatc
gagaaaattcaaaaatgcatcgctgaattttacggcgcgcaacccgcgaatagccccgat
tatggcagaattatcgatcgcaaacaattcgatcgcttagttgccttgctagcggatggc
aagatagtttttgggggagaaacagatgccgagtcacgctatattgcacccactgtcatt
gagttagcttccctagacgtgccagcaatgcagtcagaaatttttggtcccattttacca
gtcgtgacttaccaacatatatctgaggcgatcgcgatcgttaatcaaggatcgaaaccg
ttggctttatacctcttttctcgtgacagaaacctgcaaaagcgcgttctagcagaaact
tcctctggtagcgcctgcatcaacgacaccgtattgcaatttgtcgttcccacactaccc
tttggtggagtgggtagtagtggcatgggaaaatatcacggcaaggctagttttgacata
ttttcgcactacaagagcgtactgtatcgttctctggcgatcgagattaatttacgctat
cctccctatcgcggcaagttacccttacttaagcgcattttaggttag

DBGET integrated database retrieval system