KEGG   Caldimicrobium thiodismutans: THC_1768Help
Entry
THC_1768          CDS       T04224                                 

Definition
(GenBank) prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
cthi  Caldimicrobium thiodismutans
Pathway
cthi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cthi01100  Metabolic pathways
cthi01110  Biosynthesis of secondary metabolites
cthi01130  Biosynthesis of antibiotics
cthi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cthi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THC_1768
Enzymes [BR:cthi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     THC_1768
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     THC_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT
Motif
Other DBs
NCBI-ProteinID: BAU24128
UniProt: A0A0U5B7Q9
LinkDB All DBs
Position
1758093..1759169
Genome map
AA seq 358 aa AA seqDB search
MDKKLFPLRARIDQIDAEIIKLLKERLKLAQEIGRIKESKGVQTFDLGREKQILKRVLEL
NQGVFPEETLKIIYSEIIRACRASQEKPRVAFLGPEATFSHIAAQHYFGTSAQFIPVETI
IDVFEEVSSERAHFGVVPIENSIEGVVATTLDAIYEYGLKVCGEIYEAISHHLMNQTGRL
EDIKKILSHPQAIAQCRKWLRKKLPSVPIETVSSTAFAAKWAAVDETVAAIASLMAAKIY
HLQIVAKNIEDLKGNSTRFWIIGKVEMPPTGEDKTSLIFSVADKPGALFEVLKCFAERKI
NLTKIESRPSKNEPWKYIFFLDCEGHIKDQEVSNCLEEMQKYCIQVVWLGSYPKGRQV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaagctatttcccttaagagccaggattgatcaaattgatgcagaaataata
aagcttttaaaagagagacttaagcttgctcaagagattggcaggattaaagaatccaaa
ggggttcaaacctttgatctgggcagggaaaagcaaattcttaaaagagttcttgagctt
aaccagggggttttccctgaggagacccttaagataatttattcagagattattcgagcc
tgtagggcctcacaggaaaagccaagggtagcgtttcttggcccagaggcaacctttagt
catattgctgcccaacactattttggaacttctgcccaattcattcctgttgagaccatt
attgatgtttttgaggaagtaagttctgagagggcccattttggagttgtcccgatagaa
aattccattgaaggggttgtggcaaccactctggatgctatttatgagtatggccttaag
gtttgtggagaaatttatgaagctataagtcatcatcttatgaatcagacgggaagactt
gaggatataaaaaagattctctcccatcctcaagcaattgcccaatgtaggaaatggctc
agaaaaaaacttccatctgtgcccattgaaacggtttcttcaaccgcctttgcagctaaa
tgggcagctgtggatgagaccgttgctgctatagccagtcttatggctgctaaaatttat
catctccagattgtagctaaaaacattgaagaccttaaggggaattctacgcgattctgg
ataattggaaaagttgagatgccaccaacaggtgaggataaaacttcacttattttcagt
gttgctgataagcccggagctctttttgaggtgctaaagtgttttgccgagaggaaaata
aatctaacaaagattgagagtagaccctccaaaaatgaaccctggaaatatatctttttc
cttgactgcgagggccatattaaagatcaagaggtatctaactgtcttgaagagatgcaa
aaatattgtattcaagtggtttggcttggttcttatcccaagggaagacaggtttaa

DBGET integrated database retrieval system