KEGG   Chlamydia trachomatis RC-J/953: CTRC953_00540Help
Entry
CTRC953_00540     CDS       T02767                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cthj  Chlamydia trachomatis RC-J/953
Pathway
cthj00061  Fatty acid biosynthesis
cthj00780  Biotin metabolism
cthj01100  Metabolic pathways
cthj01130  Biosynthesis of antibiotics
cthj01212  Fatty acid metabolism
Module
cthj_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cthj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CTRC953_00540
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CTRC953_00540
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CTRC953_00540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cthj01004]
    CTRC953_00540
Enzymes [BR:cthj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CTRC953_00540
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CTRC953_00540
Lipid biosynthesis proteins [BR:cthj01004]
 Fatty acid synthase
  Component type
   CTRC953_00540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: AGR97248
LinkDB All DBs
Structure
PDB: 

Position
complement(119422..120318)
Genome map
AA seq 298 aa AA seqDB search
MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFSQSWELGKFNA
SRELSNGELLTFAKIYPMDASFDTPEDIPQEILENKRYKDLSGYTVSEVVEQVKKDFGHI
DILVHSLANSPEIAKPLLDTSRKGYLAALSTSSYSFISLLSHFGPIMNAGASTISLTYLA
SMRAVPGYGGGMNAAKAALESDTKVLAWEAGRRWGVRVNTISAGPLASRAGKAIGFIERM
VDYYQDWAPLPSPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGIGPEMFPKD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaattgatttaacaggaaaaattgctttcatagccggcataggcgatgataac
gggtatggctggggcattgccaaaatgttagcagaagcaggcgcaaccatacttgtgggg
acctgggttcctatctataaaattttctctcaatcttgggagttaggaaaattcaatgca
tctcgtgaactctccaatggagaattgctaactttcgctaaaatctatcccatggatgcc
agtttcgacaccccagaagatattcctcaggaaattttggaaaataaacgttacaaagat
ctttctgggtacactgtatccgaagttgtagaacaggtgaaaaaagattttggacacatt
gatattcttgttcactctttagcaaacagtccggaaattgctaaaccattacttgatacc
tctcgtaaaggctatcttgccgccttaagtacatccagctactcctttatcagccttctc
tctcattttggcccaattatgaatgcaggagctagcaccatctctctaacttatcttgct
tccatgcgtgctgttccagggtatggcggaggaatgaacgcagcaaaagctgctttagaa
agtgatacaaaagtactggcttgggaagccggccgacgttggggagtccgagtgaatact
atctcggcagggccattagctagccgtgcaggaaaagctattggatttattgagagaatg
gtggattactaccaagactgggctccactaccttctccaatggaagctgagcaagtaggc
gcagcagcagccttcttagtctctcccctagctagcgcaattacgggagaaactctctat
gtggatcacggagccaatgtgatgggcataggtccagaaatgtttcctaaggattaa

DBGET integrated database retrieval system