KEGG   Carboxydocella thermautotrophica: CFE_0180Help
Entry
CFE_0180          CDS       T05389                                 

Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
cthm  Carboxydocella thermautotrophica
Pathway
cthm00340  Histidine metabolism
cthm01100  Metabolic pathways
cthm01110  Biosynthesis of secondary metabolites
cthm01230  Biosynthesis of amino acids
Module
cthm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cthm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CFE_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: AVX19389
UniProt: A0A2R4MX58
LinkDB All DBs
Position
183892..184968
Genome map
AA seq 358 aa AA seqDB search
MEKEKFWRIPAGVRDWLPGERASRRQLEEVMTRTFALWGYREVATPTLEYWDSISLGLND
EGREVIKLIDRNGDILALRPDWTTPIARLTASRLAQWPLPLRLFYSGQVFTQVEPQVGRW
REYGQAGVELIGLPGGWADGEVVALAAESLLAAGLKEFQLHLGHMGLLQGLMAEQGLTPE
QEREVKAAVSRKDLVRAEQLLGRGAELLTLRGGREMLVRAEQLTRGPEAAQALAELGETM
DYLEAYGLAERIVLDFSLLRGLDYYTGVIFEGFAPGLGFSLCGGGRYDGLLARFGQPLPA
TGFAIGYERLLLALERQGVNRQGMDTEVRLQRREKNWTEVLAEARRRRAAGEIVIVEG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagaaaaattctggcgcataccggcaggagtgcgagactggttgccgggggaa
agagccagccgcaggcagctggaggaggttatgacccggacttttgccctctggggttat
cgggaggtggccactcccaccctggaatactgggatagcatcagcctgggcctaaatgat
gagggcagggaagtcattaagttaattgaccgcaatggcgatattctggccctgcggccg
gactggaccactccaattgcccggctgacggccagtcgcctggcccagtggcccttgccc
ctgcgccttttttacagtggccaggtttttacccaggtagaaccgcaggtagggcgctgg
cgggagtacggccaggccggggtggagttgatcggcttgccgggaggctgggctgatggg
gaagtagtggccctggctgctgaaagcctgctggccgccggcttaaaggaatttcaactg
catctgggacacatgggattactgcagggtctgatggctgaacagggcctgactcctgaa
caggagagggaagtgaaagccgctgtgtccagaaaagacctggtgcgggcggaacagctg
ctgggtcggggagcggaactgctgaccctgcggggaggccgggagatgctggtgcgggca
gagcaactgaccaggggaccggaagcggctcaggctctggccgagctgggggaaaccatg
gactacctggaggcttatggcctggcggaacggattgtcctggacttcagcctgctcaga
gggctggattattataccggtgtaatttttgaaggctttgcccccggcctgggcttctcc
ctttgcggaggcggccgttatgatgggctgctggcccgcttcgggcagccgttacctgct
actggctttgccataggctatgaacggctgctcctggctctggaacggcagggagtaaat
agacaggggatggataccgaggtacggttacagcggagggaaaagaactggacagaagtg
ctggctgaggccagaaggcgccgggcagcaggggagatagtgatagtggagggataa

DBGET integrated database retrieval system