KEGG   Carboxydocella thermautotrophica: CFE_0192Help
Entry
CFE_0192          CDS       T05389                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase/phosphoribosyl-AMP cyclohydrolase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
cthm  Carboxydocella thermautotrophica
Pathway
cthm00340  Histidine metabolism
cthm01100  Metabolic pathways
cthm01110  Biosynthesis of secondary metabolites
cthm01230  Biosynthesis of amino acids
Module
cthm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cthm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CFE_0192
Enzymes [BR:cthm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     CFE_0192
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     CFE_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG DUF3239 DUF4378
Motif
Other DBs
NCBI-ProteinID: AVX19401
UniProt: A0A2R4MXD4
LinkDB All DBs
Position
193088..193723
Genome map
AA seq 211 aa AA seqDB search
MKQKGIQDLQFGPDGLLPAIVQDVHTREVLMLAYMNRQALERTLATGRTWFWSRSRQQLW
NKGETSGHYQLVREIAYDCDADALLIKVEQVGVACHTGEYSCFHNRLSFGEREEQESLAG
SEILVELWRVIKERQETRPEGSYTAKLFNQGLDKILKKVGEEAAEVIIAAKNRQPEEVAW
EAADLIYHLWVLLAEQGMEPARVYRELAKRR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaagggaatccaggacttgcagtttggccccgatggcctgctgccggctatt
gttcaggatgtgcataccagggaagtgctgatgctggcttatatgaaccggcaggctctg
gaacggaccctggccacagggcgtacctggttctggagtcgcagtcgccagcagttatgg
aataaaggggaaacctccggccactaccagctggtacgggaaatcgcttatgactgtgat
gccgatgcccttcttatcaaggtggaacaggtgggggtagcctgtcataccggggaatat
tcctgttttcacaatcgcctcagttttggggagagagaagagcaagaaagcctggcgggc
agtgaaattctggtggaactctggcgagtaatcaaggagcggcaagagaccaggccggag
ggctcttatactgccaaacttttcaatcaggggctggataagatcctgaaaaaagtggga
gaagaggcggccgaggtaattatcgctgccaaaaaccgtcagcccgaggaagtggcctgg
gaagctgctgacctgatttatcacctctgggtactgctggcggaacagggcatggaaccg
gcccgggtctaccgggagctggccaaacggagatga

DBGET integrated database retrieval system