KEGG   Carboxydocella thermautotrophica: CFE_1639Help
Entry
CFE_1639          CDS       T05389                                 

Definition
(GenBank) NIMA (never in mitosis gene a)-related kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cthm  Carboxydocella thermautotrophica
Brite
KEGG Orthology (KO) [BR:cthm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cthm01001]
    CFE_1639
Enzymes [BR:cthm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CFE_1639
Protein kinases [BR:cthm01001]
 Serine/threonine kinases: Other
  Bacterial family
   CFE_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr NERD Haspin_kinase APH AbiJ_NTD4
Motif
Other DBs
NCBI-ProteinID: AVX20814
UniProt: A0A2R4N163
LinkDB All DBs
Position
complement(1600831..1603170)
Genome map
AA seq 779 aa AA seqDB search
MATVLKEVSRISGLYGLDGEEKVAKELAEQLPEYFLVINSPRLAMNDNVVDIDHIVITPA
AIFVIESKNMNGRITGGLMGNWTQERLNDGKKEYIKIGNPAAQVNQYTKVVRDYLKHHYY
QQYQVQKNFKMEPIVVFTHEHSNINGIHYTSRGRVGKVRVLLLKDLVSHIMSFDKEYMTL
EEMHEVADILVPQDQREQTGVYPVLNDLPKESFRSRYQILEEIGRGATGVVFRAFDNKLD
LEVAVKRLYAGQDGEKHKQWKQIARISARLNHANIVRIHDYYEEDGEFYLVMDLVQGLTL
SEALEQRQFSWREIYDILEQICNALDYAHREGVIHLDLKGDNILIDEKGLVHVTDFGLAA
LAELGPSKSIGTPLYMAPEQVRGERGDKSSDWFAVGVILYQLITGHFPFYGKDLREVGQD
ILYGQPPPLTRWREDAPAELEKVLAKALAKEARQRYQSGRELLADLKTALGERLESGQGL
TQQWFANQRWLNFWRDDKKKFYVIVALTALIFGWMFSLQMYIDRKFPQSGSSTTGELLQD
SRLDTTLITNENINQAYNKVEEWSGRKVKITGRLEKLVNRTEDYLLLQMAVSDSKGAITR
ILVQYNGDPHLLLQKEESLPLVRLVGNLGSTTTVDPRNGEIIKIPLIVNSVIEPIELWNA
MTPAKYKLDVKQILVRHGIEVELERIEIAEEETRLFLRVKNRSLQKHLVSLANPQARQGN
NIIYQLYHSENNYQFELQPEQEVKGQIILGPLDIIQRQVEISLGNNFLGQEPWVFSVKW
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
gtggccacagtattgaaggaagtatcccgtatctccggactttatggtcttgatggcgaa
gaaaaagtagccaaagagctggcggaacagcttccggaatattttctggtgattaactca
ccgcgcctggcaatgaatgataatgtggtggatattgaccatattgtgattacgccggcg
gcgatctttgtcatcgagagtaaaaacatgaatggccgtatcaccggcggcctgatgggc
aactggacccaggagcgattaaatgatggcaagaaggaatatatcaagataggcaatcct
gccgctcaggttaatcagtataccaaagttgttcgggactatttaaaacatcattactat
cagcaataccaggtccaaaaaaattttaagatggaacccattgtagtttttacccatgaa
cattccaatattaatgggattcactacacttcccggggaagggttggtaaggtcagggtt
ttgttgttaaaggacctggtttcccatattatgagctttgataaggaatatatgacttta
gaggagatgcatgaggtagctgatatcctggtgcctcaggatcagcgggaacaaaccggg
gtttatccggtgctgaacgatttgcccaaagaaagttttcgcagccggtatcagattctg
gaggagataggccggggagctaccggggtggttttccgcgcctttgacaataagctggat
ctggaagtagcagtaaagcggctgtatgcgggccaggatggagagaaacataaacagtgg
aagcagattgcccggatttctgcccgtttgaatcacgccaatatagtacgcatccatgat
tattacgaagaggatggcgagttttacctggtcatggacctggttcagggtttgaccttg
agtgaggctctggaacaaaggcaatttagctggcgcgaaatctatgatattctggaacaa
atatgtaatgccctggactatgctcatcgagaaggggttattcatctagacctcaaaggg
gataatattctcattgatgaaaaaggactggtgcatgttactgattttggtctggcagcc
ctagcggagctgggccctagcaaaagcataggcactcccctctatatggcacccgaacag
gtaagaggagaaaggggggataaatcttctgactggtttgcggtcggagttatcctgtat
caattgataaccggacattttcctttttatggaaaagacttgcgagaagtaggacaggat
attttatacgggcaacccccgccgttaacccgctggcgggaggatgcaccggcagaactg
gaaaaagtgctggccaaagccctggccaaagaagccaggcagcgctatcaaagcgggcgg
gagttactggctgatttaaaaactgctctgggtgaacgccttgaaagtggacagggcttg
acccagcaatggtttgccaatcagcgctggttaaatttctggcgggatgataaaaagaaa
ttttatgtcattgtggccctaacggcattaatcttcggctggatgttcagtttacaaatg
tatatagaccggaagttcccccaatccggcagcagtacaacaggggaattattacaggat
agccgtctggatactactttaattaccaatgaaaatataaatcaggcttataataaagtt
gaagaatggtccggacgcaaagttaagattacaggtagactggagaagctggttaatcgt
acagaagattatctcttgttacaaatggctgtttcagatagcaaaggagctattaccaga
atcctggtccagtataatggggatccccatctccttctgcaaaaagaagagagtttgcct
ctggtcagactggtaggcaatctgggctcaactactactgttgatccccgcaatggggaa
ataataaagatacccttgatagtcaacagtgtaattgagccaattgaattatggaatgcc
atgacaccagctaaatacaaattggatgttaagcagatactggtgcgacatgggatagag
gtagagctggagcggatagaaatagcagaggaggaaacgcgtttattcttaagggtcaag
aatcgttccttgcaaaaacatctggtctctctggctaatcctcaggctagacaaggaaat
aatatcatctaccagctttaccatagcgaaaacaattatcaattcgagttacaacccgaa
caggaggtaaaagggcaaattatccttgggccccttgatattatccagcggcaagtcgaa
attagtttggggaataattttttgggacaggaaccctgggtattttcagtcaagtggtag

DBGET integrated database retrieval system