KEGG   Carboxydocella thermautotrophica: CFE_1933Help
Entry
CFE_1933          CDS       T05389                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cthm  Carboxydocella thermautotrophica
Pathway
cthm00473  D-Alanine metabolism
cthm01100  Metabolic pathways
cthm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cthm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFE_1933
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CFE_1933
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cthm01011]
    CFE_1933
Enzymes [BR:cthm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CFE_1933
Peptidoglycan biosynthesis and degradation proteins [BR:cthm01011]
 Precursor biosynthesis
  Racemase
   CFE_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Orn_Arg_deC_N
Motif
Other DBs
NCBI-ProteinID: AVX21103
UniProt: A0A2R4N1Y5
LinkDB All DBs
Position
complement(1912381..1913505)
Genome map
AA seq 374 aa AA seqDB search
MHCRPVWAEIDLGAIGHNVRELRRVTQPRARLMAIVKANAYGHGAVEVARVALANGAERL
GVALLQEAIELRRAAFGVPILILGYTPPDGALDVVKYNLTQTVFDYQGAEALSWAAVQLR
KTAKIHLKLDTGMGRLGFVTTNPRSLEEILRIARLPGLEIEGIYTHFASSDSKDKTSALR
QLELFRNFVDQLEKLGLEIPLKHTANSGAILDMPSAHLDLVRAGIALYGLYPSDEVKKEK
VALRPAMTLKARIAYVKEVGPGSGISYGSTYVTSGWERIATIPLGYADGYNRRLSNRAEV
LIKGQRCPVVGRVCMDQFMVRVSHLEQVTAGEEVVLFGRQGQAELPVDELASMLDTINYE
LVCAVSSRVPRIYV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcattgccggccggtttgggcggaaatagatttgggagcgataggacataatgtgcgg
gaactcaggcgggtaacccagccccgggccaggttgatggcaattgtcaaggccaatgcc
tacgggcatggggcggtggaagtggcacgggtagccctggctaacggagcagaacgcctg
ggggtggcccttttacaggaagccattgaattgagacgggccgccttcggggtgcccatc
ctgattctgggctatacgcctcctgatggggctctggatgtggttaaatataacctgact
cagactgtttttgattaccagggagcagaagccctctcctgggcagcagtacagctgcgc
aaaaccgccaaaattcatcttaaactggataccggcatgggcaggctggggtttgtcact
accaacccccgttccctggaagaaattttgcggatagcccgcttaccagggctggaaatc
gaggggatatatacccatttcgcctccagtgatagcaaggataaaacttcggctctaagg
cagctggagctcttccgcaactttgtggaccagctggaaaagctgggactggaaattcct
cttaaacacactgctaatagcggggctattctggatatgccctctgcccatctggatctg
gtacgggccgggattgccctctatggcctgtacccttccgatgaagtgaaaaaggaaaaa
gtggccctgcgtccggcgatgaccttgaaggcgcgcatcgcctatgttaaggaagtgggg
cctggcagcgggatcagttatggctcaacctatgtcaccagtggctgggaaaggattgct
accatcccgctgggttatgctgacggctataaccgccggctttccaaccgggccgaagtg
ctgatcaaaggccagcgctgcccggtggtagggcgggtttgtatggatcagtttatggtg
cgggtctcccatctggagcaggtaacagccggggaggaagtggtcctttttggccggcag
ggccaggctgaattgccggtggatgaactggccagcatgctggatactatcaattacgag
ctggtttgtgcagttagcagcagggtgccccgcatctatgtctaa

DBGET integrated database retrieval system