KEGG   Carboxydocella thermautotrophica: CFE_2060Help
Entry
CFE_2060          CDS       T05389                                 

Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cthm  Carboxydocella thermautotrophica
Pathway
cthm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cthm01100  Metabolic pathways
cthm01110  Biosynthesis of secondary metabolites
cthm01130  Biosynthesis of antibiotics
cthm01230  Biosynthesis of amino acids
Module
cthm_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cthm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CFE_2060
Enzymes [BR:cthm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     CFE_2060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 NeuB
Motif
Other DBs
NCBI-ProteinID: AVX21226
UniProt: A0A2R4N289
LinkDB All DBs
Position
complement(2042436..2043245)
Genome map
AA seq 269 aa AA seqDB search
MEMQVLKNPNPKPVKVGEIFFGGSQVVPMAGPCAVESRQQVLACAEALQKLGIKVMRGGA
FKPRTSPRGFQGLGEAGLELLAEVKAKYGLLLVSEVIDEDSLRAGAEVLDIIQIGSRNMQ
NFSLLRKVGRLGKPVLLKRGLAATLQEWLAAAEYILAEGNDQIILCERGIRTFEPATRNT
LDLGAVAWLKQEVGFPVVVDPSHASGQRRLVGPLARGAVACGADGLLIEVHPEPDQALCD
GQQSLNFEQFARLLQELEPVARAVGKSLA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgcaggtattgaaaaaccccaatcctaaaccggtgaaggtgggtgagatcttt
tttggcggcagccaggtggtacccatggccggtccttgcgccgtggaaagccgtcaacag
gttctggcctgtgctgaagcgctgcaaaaattaggaataaaagtcatgcgcgggggtgct
tttaaaccccgtaccagtcccagggggtttcagggcctgggggaagctggcctggaatta
ctggctgaagtaaaagcgaaatacggacttttgctggtttcggaagtaatcgatgaggat
tccctgcgggcgggagcagaagtgctggatatcatccagatcggttctcgcaatatgcag
aatttcagccttttgcgcaaagtcggtcgcctgggtaaaccggtactcctgaagcggggc
ctggcggccaccctgcaggaatggttagcggcagccgaatacattctggcggaaggcaat
gatcagattattctctgtgaacgggggattcgcacctttgaaccggctacccgcaatacc
ctggacctgggggcggtagcctggctcaaacaggaagtgggttttccggtagtggtggac
cccagccatgccagcgggcaaagacggctggtggggccgctggcccggggagcggtagcc
tgtggtgctgatgggcttttgattgaagtgcatccggagcctgaccaggctttgtgtgat
gggcaacaatccctcaatttcgagcaatttgcccgcctcttacaggaactggagcctgtg
gcgagggcggttggaaaaagtttggcataa

DBGET integrated database retrieval system