KEGG   Carboxydocella thermautotrophica: CFE_2117Help
Entry
CFE_2117          CDS       T05389                                 

Definition
(GenBank) succinate dehydrogenase / fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cthm  Carboxydocella thermautotrophica
Pathway
cthm00020  Citrate cycle (TCA cycle)
cthm00190  Oxidative phosphorylation
cthm00650  Butanoate metabolism
cthm01100  Metabolic pathways
cthm01110  Biosynthesis of secondary metabolites
cthm01120  Microbial metabolism in diverse environments
cthm01130  Biosynthesis of antibiotics
cthm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cthm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFE_2117
   00650 Butanoate metabolism
    CFE_2117
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFE_2117
Enzymes [BR:cthm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CFE_2117
    1.3.5.4  fumarate reductase (quinol)
     CFE_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_20 Fer4_2 Fer4 Fer4_13 Fer4_16
Motif
Other DBs
NCBI-ProteinID: AVX21282
UniProt: A0A2R4N2F1
LinkDB All DBs
Position
complement(2099688..2100440)
Genome map
AA seq 250 aa AA seqDB search
MAEQKYIHLRVRRQESPQAKPYWEEFKIPYKPNMNVISALMEIQKNPVNAQGEKTTPVVW
ECNCLEEVCGACTMLINGVPRQACSALIDQLQQPVELRPLTKFPLIRDLMVDRSIMFENL
KKVKAWIPIDGTYDLGPGPKLAAKTQEWAYELSRCMTCGCCMEACPQVNSKSKFIGPAAI
SQVRLFNTHPTGEMNKEERLEAIMGDGGITDCGNSQNCVRVCPKQIPLTTSIADMNKETV
KYAIKRWLRK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaaaaatacattcacctgcgggtacggcggcaggaaagtccccaggccaaa
ccctactgggaagagtttaaaatcccgtataagcccaatatgaatgtaatttccgccttg
atggaaattcaaaaaaatcccgtcaatgcccagggggaaaaaactacgccggtagtgtgg
gaatgcaattgtctggaagaagtttgcggggcctgtacaatgctaataaacggggttccc
agacaggcttgctcggctttgattgaccagttacaacagcctgttgaattgagacctctg
accaagtttcccctgattcgcgatttgatggtagaccgcagcatcatgtttgaaaatctg
aaaaaagtcaaagcatggattcctatcgatggtacctatgatctggggccagggcccaaa
ctggcggccaaaacccaggaatgggcctatgaattatcccgctgtatgacctgtggttgc
tgcatggaagcctgtccccaggtgaacagcaaatccaaattcatcggtccggcagctatc
tcccaggtgcgcttgttcaacactcatccgaccggggaaatgaacaaggaagagcggttg
gaagccattatgggagatggggggattacggattgtggtaattcccagaactgtgtgcgg
gtttgtcccaaacagattcccctgactacctccattgcggatatgaataaagaaacggta
aaatatgccattaaacgctggttaagaaaatag

DBGET integrated database retrieval system