KEGG   Carboxydocella thermautotrophica: CFE_2118Help
Entry
CFE_2118          CDS       T05389                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cthm  Carboxydocella thermautotrophica
Pathway
cthm00020  Citrate cycle (TCA cycle)
cthm00190  Oxidative phosphorylation
cthm00650  Butanoate metabolism
cthm01100  Metabolic pathways
cthm01110  Biosynthesis of secondary metabolites
cthm01120  Microbial metabolism in diverse environments
cthm01130  Biosynthesis of antibiotics
cthm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cthm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFE_2118
   00650 Butanoate metabolism
    CFE_2118
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFE_2118
Enzymes [BR:cthm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CFE_2118
    1.3.5.4  fumarate reductase (quinol)
     CFE_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored NAD_binding_8 AlaDh_PNT_C Thi4
Motif
Other DBs
NCBI-ProteinID: AVX21283
UniProt: A0A2R4N2H0
LinkDB All DBs
Position
complement(2100440..2102245)
Genome map
AA seq 601 aa AA seqDB search
MRCSALSEAKGVRRKMAEKKIIVVGGGLAGLMATIKAAEAGFKVDLFSLVPVKRSHSVCA
QGGINGAVNTKGEGDSPWEHFDDTIYGGDFLANQPPVLKMCEAAPGIIHLMDRMGVMFNR
TPEGHLDFRRFGGTKHHRTAFAGATTGQQLLYACDEQVRRWEAAGLVQKYEGWDFLSIVL
DEQGICRGITAQNLASMEIRAFRGEAVIMATGGPGMIFGKSTNSTINTGWAAAAVYMQGA
CYANGEFIQIHPTAIPGEDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPR
DIATREIFYVCVDLKLGINGQNMVYLDVSHIDPKVLDRKLGGILEIYEKFVGEDPRKVPM
KIFPGVHYSMGGLWVDYNHMTNIPGLFAAGECDYQYHGANRLGANSLLSAIYSGMIVGPA
AVAYASGLSKSAFALEERLFEQERKRQEEKVEAIYRMNGKENPYLLHEELGKWMTDNVTV
VRYNDRMEKTDAKIQELMERYQNINLADTGRWSNQCVMFVRHLWGMLQLARVITRGAIAR
NESRGAHYKPEFPNRDDENWLKTTKAFYTPAGPRLEYEPVDVSLIKPRPRKYDVDKSEVK
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgttcggctttatcagaggctaaaggggtgagaaggaagatggcggaaaagaag
attatcgttgttggtggcggcctggccggcctgatggctaccattaaggcagcagaggct
ggcttcaaggttgatcttttctctctggtaccggtaaaacgcagtcactccgtttgtgcc
cagggggggattaatggtgccgttaacaccaagggggaaggggattctccctgggagcat
tttgatgataccatttatggcggggactttctggccaatcaaccaccggtgctgaaaatg
tgtgaagcggcacctggaattatccatttgatggaccggatgggagtaatgttcaaccgc
acaccggaaggacatctggatttccggcgttttggtggtaccaaacaccatcgtaccgct
tttgctggagcgaccaccggccagcaattactttatgcctgtgatgaacaggtacggcgc
tgggaagcagctggtctggtgcaaaagtatgagggctgggatttcctttccattgtgctg
gatgagcaggggatttgccgggggattaccgcccagaacctggctagcatggaaatcagg
gccttccggggtgaagcggtgattatggccaccggtggcccgggcatgatctttggcaag
agtaccaactccactatcaataccggctgggcggcggcggcagtttacatgcaaggcgcc
tgctatgccaacggggagtttattcagatccatcctactgctattccaggagaggataaa
ttgcgtttgatgtccgaatcggcccgcggtgaaggcggtcgggtctggacttacaaggat
ggtaaaccctggtatttcctggaagaaaaatatccggcctatgggaacctggtaccgcgg
gatatcgctacccgggagattttctatgtctgtgtggatttgaaactggggataaatggt
cagaacatggtttatctggatgtttcccatatagatcctaaagtgctggaccgcaagctg
ggcgggattctggagatctatgaaaaatttgttggggaagatccccgcaaagtgccgatg
aagatattcccgggtgtccactattccatgggcgggctctgggtggattacaatcatatg
accaatattcccggattgtttgctgccggggaatgtgactaccagtaccatggtgctaac
cgcctgggtgccaactccctgctttctgccatttatagtggcatgatagtgggaccggca
gcagtggcctatgccagcggtttgagcaagtcggcctttgctctggaggaaaggctgttt
gaacaggagcgcaaacggcaggaggaaaaggtggaagccatttaccggatgaatggcaag
gaaaatccctatctgcttcatgaagagctgggtaaatggatgaccgataatgtcacggta
gtgcgctataatgaccggatggaaaaaaccgatgccaaaattcaggaattgatggagcgc
taccagaatatcaatctggcggataccggccgctggtccaaccagtgtgtgatgtttgtg
cgccatctctggggtatgctgcagctggcccgggtgattaccagaggggctattgcccgc
aatgaaagccggggtgcccattataagccggagtttcccaaccgggatgatgaaaactgg
ctgaagaccaccaaggccttctatactcccgctgggccacggctggaatatgagccggtg
gatgtctccctgatcaagccccggccgcgcaaatacgatgtggataaatcggaggtgaag
gcctga

DBGET integrated database retrieval system