KEGG   Carboxydocella thermautotrophica: CFE_2339Help
Entry
CFE_2339          CDS       T05389                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cthm  Carboxydocella thermautotrophica
Pathway
cthm00030  Pentose phosphate pathway
cthm01100  Metabolic pathways
cthm01120  Microbial metabolism in diverse environments
cthm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cthm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CFE_2339
Enzymes [BR:cthm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CFE_2339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AVX21482
UniProt: A0A2R4N2Z0
LinkDB All DBs
Position
complement(2298826..2300622)
Genome map
AA seq 598 aa AA seqDB search
MFNAYSGKILRINLTTGSITTEALPVEKARAFLGGRGLGGRMLAEEIPAGIDPLSEANKI
FFITGPLTGTSAPTSGRYMVVTKSPLNNTIASSNSGGFWGAELKFAGYDMVIVEGKAAKP
VYIYIKDDQVEIRPADKYWGKLVSETTDGLLAEAGDDKARVLTIGPAGERLSPIAAVMND
RYRAAGRSGVGAVMGSKNLKAIVVRGSGKVEVAQPDRFKEVVSGLLKKIRENGVTGQGLP
AYGTAVLVNIINESGILPTNNFQEAYFPAADEISGETLAEKYLKKKDPCYRCPIACGRYC
EVDGEEGGGPEYETIWAYGSDCGVSDLKAIIKANNLCNEYGLDTISAGATIAAAMELYQR
GIIKPEEVDGPELKWGSGEAIVEWTRKMGAGEGLGAKLALGSARLCEAYGHPELAMAVKK
QELPAYDPRGVQGHGLQYATSNRGGCHVRGYMISPEILGLPEKLDRFSLEGKAEWVKVFQ
DLTAVIDSLGLCLFTSFALGAQDYADLYNAATGENLTAEQLLACGERIWNNERLFNLQEG
YTAQDDTLPRRLLEEPIPDGPSKGSVHRLAELLPVYYQVRGWDENGVPTAARRQELGL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaatgcttattcgggtaaaattctgcgcatcaatttaactaccggttctatcacc
accgaagccctgccggtggagaaagccagagcctttctcggcggccggggcctggggggc
cgcatgctggccgaggaaattccggctggtatcgatcctttgagtgaagctaacaaaatc
tttttcattaccggtccgcttaccggtacttccgctccgacttccggacgttacatggta
gttaccaaatcccccctcaacaataccattgcctcttccaactccggaggtttctggggc
gcagaactgaaattcgctggctatgacatggtgattgtagaagggaaagcagccaaaccc
gtatatatctacatcaaggatgaccaggtggaaatccgccctgccgacaagtactggggc
aaactggtcagtgaaaccactgacggacttctggctgaggcaggagacgacaaggccagg
gtattgaccatcggtccggccggggaacggctatctcccatcgctgccgtcatgaatgac
cgctaccgggccgcaggccgttccggggtaggtgccgtcatgggttctaagaacctgaag
gccatcgtggtgcgaggcagcggtaaggtagaagtagcccagcccgaccgcttcaaggaa
gtggtcagcgggctgttgaagaaaatccgggagaacggcgtcaccggccagggcctgccg
gcttatggcacagcggtgctggtcaatatcatcaatgaaagcggcatattgcccaccaac
aactttcaggaagcctatttcccggctgccgatgaaatctccggggaaactctggcggag
aaatacctgaaaaagaaagatccctgttatcgctgtcctattgcctgtggccgctactgt
gaagtagacggggaagaagggggcggtccggagtatgaaaccatctgggcctatggctct
gactgtggcgtctccgacctgaaagcgataatcaaggccaacaatctctgcaatgagtac
ggtttggataccatctcagctggagctaccattgcggcggccatggagctctaccagcgg
ggcatcatcaagcccgaggaagtggatggaccggagctgaaatggggcagtggggaagcc
atcgtggaatggacccgcaagatgggagccggggaaggcctgggggccaaactggcgctg
ggttccgcccggttgtgtgaggcctatggccatccggagctggcgatggcggtcaagaag
caggaactgccggcctatgacccgcggggtgtgcagggccatggtttgcagtatgctacc
tccaaccggggtggctgccatgtgcggggttacatgatttccccggaaattctgggcttg
ccggagaaactggaccggttctccctggaggggaaagcggaatgggtgaaggtattccag
gacctgacggcagtaatcgacagcctggggctgtgcctgttcacctcctttgccctgggg
gcgcaggattatgccgacctgtataatgccgccaccggggaaaacctgacagcagaacaa
ctgctggcctgcggggaacggatctggaacaatgagcgcctgttcaacctgcaggagggc
tataccgctcaggacgataccctgccccggcgtttactggaagagcccattccggacggg
ccgtccaagggcagtgtgcaccggctggcagaactgttgcctgtctattaccaggtgcgg
ggctgggatgaaaacggagtgccaacagcggccaggagacaggaactggggttataa

DBGET integrated database retrieval system