KEGG   Chaetomium thermophilum: CTHT_0008220Help
Entry
CTHT_0008220      CDS       T03100                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00250  Alanine, aspartate and glutamate metabolism
cthr00410  beta-Alanine metabolism
cthr00430  Taurine and hypotaurine metabolism
cthr00650  Butanoate metabolism
cthr01100  Metabolic pathways
cthr01110  Biosynthesis of secondary metabolites
Module
cthr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cthr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CTHT_0008220
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CTHT_0008220
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CTHT_0008220
   00430 Taurine and hypotaurine metabolism
    CTHT_0008220
Enzymes [BR:cthr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CTHT_0008220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DUF1682
Motif
Other DBs
NCBI-GeneID: 18254860
NCBI-ProteinID: XP_006691352
UniProt: G0S000
LinkDB All DBs
Position
Unknown
AA seq 824 aa AA seqDB search
MSLARHVNPEDIIHHLQHEDTGPLIAQAIPGSSHLTPFSTPYASRRDIPKYRIPQHGTPG
DTVYQMLKDELDLDGRPNLNLASFVNTYLEDNAKSLLSANANKNLADNDEYPALLDLSKR
CVSILAHLWGVQKGEKAVGSPTVGSSEAIHLGGLAMKRSWQQRRREQGKDASRPNIIMGA
NAQVALEKFARYFDVEARILPVSAKSKYRLDPELVRENVDENTIGVFVILGSTYTGHYEP
VEEVAQVLDEYQKNTGIDIPIHVDAASGGFVAPFTFAGAGGAKWNFEIPRVHSINTSGHK
YGLVTAGLGWIIWRDEAYLPQDLIFKLHYLGGTEESFTLNFSRPGAQVVVQYYNFIHLGF
DGYREAMENCLANARMLSKSLEETGWYTCVSDIHRPVQGKREPKGGETSASYVAGLPVVS
FRLTDDFRRQFPHIQQETISLLLRARQWIIPNYALPPNVNSTEILRVVVRVNMSLDMLDR
LITDIVQVTEMLMERDEVDLSVLKEQRERREEVQEKDKEHRRQKHRRDKVEGVEKKRMEE
GIHRGPVPTEFIHPNQIFFKETTTSIYQERRRPRGELVALGEVLPRQEGETLGQWISRLE
MVRDMTLDWAEQYEMSKLASRLGSRSASPENLDYFYSKQSPQVHLPTLWKLCGAIPREFP
QDEDKIEEVAARSTDEHYLARFTTIFRNALSKSQVRISSLAPGSPPGQLTQGSDIEPTTN
QRPRAPALKKATDSLIIHRNRKLFKRALKFLDRFPDDEEAQEEYITLWLEDTHLRSKDTS
QVTLHAALISSKIDSSNDEGNDMDESSFLDFDLDGWIEKCFGAL
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttgctagacatgtcaatcccgaggacatcatacaccatctacagcatgaagat
acgggcccattaattgctcaagcaatacctggatcttctcatctcactccattttctaca
ccgtatgccagcaggcgtgacatccccaaatacaggatcccgcagcacggcacccctggt
gacacagtgtaccagatgctcaaggatgagcttgatctagatggccgtccaaatctgaac
ctggccagttttgttaacacctacttggaggataatgctaaaagcctcctgagtgccaat
gctaacaagaatctcgctgacaacgacgagtatcctgcactcctggatcttagcaaacgt
tgtgttagcattttggcccacctctggggtgttcagaagggcgagaaggctgtcggctct
ccaactgtaggctcatccgaagccatacatttgggcggactggccatgaagcgtagttgg
cagcaacgtcgcagggagcaggggaaagatgcaagccgaccgaacattatcatgggggcc
aatgcacaggttgcactggaaaagtttgcgagatacttcgacgtcgaggcgaggatacta
ccagtatcagcgaagagcaagtatcgcctggacccagagctggtacgtgaaaatgtggat
gaaaacaccattggggtgtttgtcatcttgggaagcacgtacaccgggcactacgagcct
gtagaggaggtcgcacaagtgctagacgagtatcagaagaacactgggatcgatatcccg
attcatgttgatgctgccagcggggggttcgtggccccctttacctttgctggggcaggt
ggagctaagtggaactttgaaattccacgcgtccactccatcaacacctctggtcataag
tacggtctggtgaccgcaggactgggctggattatctggcgtgatgaagcgtatctgcca
caggacctcatattcaagctccattacctgggcggcacggaggagtcgttcacccttaac
ttctcgcggcctggcgcccaggtggtagtgcagtattataattttatccatctcgggttc
gatggctatcgcgaagccatggagaattgcctggccaatgcccgaatgctgtccaagagc
ttggaagagacgggatggtacacctgtgtcagcgatatccatcgtccagttcaaggaaaa
agagaaccaaagggaggagaaacatcagcttcttacgttgctggtcttcctgtggtgtca
ttccgcctaactgatgacttccgccgtcaattccctcacattcaacaggaaacaatttcg
ttgttgttacgggcgcgccaatggatcattcccaactatgcactaccccccaatgtgaat
tccacagaaatcctgagggtcgtggtgcgcgtcaacatgagccttgatatgcttgaccgg
ttgatcacagatattgtacaggttacagagatgctgatggaacgagatgaggtcgatttg
tcagtgttaaaagagcagagagagaggagggaggaggtacaagagaaggataaagaacac
agaaggcaaaaacacaggagggacaaagtggagggggttgagaagaagagaatggaagaa
ggcatccatcggggtcccgtccctaccgagtttatccaccccaatcaaatatttttcaag
gagacaacaaccagcatctaccaggagcgcaggcgacctcgtggcgagttggttgctctt
ggagaggtgcttcctcggcaggaaggagaaacactgggtcagtggattagcaggcttgag
atggtgagagatatgactctggattgggcagaacagtacgagatgtcgaagctggctagc
cgcttggggagtcgaagtgccagtcctgagaatttggactatttttattccaaacagagc
cctcaggtgcacctcccaacactatggaaactctgcggagccattccccgggagtttcct
caggatgaagacaagatcgaggaggtggctgctagatctacagacgaacattacctcgcc
cgctttactaccattttcaggaatgctctgtcgaaaagccaggtgagaatcagctcgctt
gcccctggttcgcctccaggccagctaacccaggggtcagatatcgagccaacgacgaac
caaagaccacgagcgccggcgctcaaaaaggccaccgactccttgattattcatcgaaac
cggaagcttttcaagagagctctaaaattcctggacaggttcccggacgacgaagaggcg
caagaagagtacataaccctctggctggaggatacccatttgcgctccaaggacaccagt
caggtaaccctccacgcggcgcttatttcttcaaagatagactcttcgaacgacgaaggt
aatgacatggacgaatcgagcttcctcgatttcgacctcgatgggtggattgagaagtgt
tttggggcgctataa

DBGET integrated database retrieval system