KEGG   Chaetomium thermophilum: CTHT_0013440Help
Entry
CTHT_0013440      CDS       T03100                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CTHT_0013440
Enzymes [BR:cthr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CTHT_0013440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 18255382
NCBI-ProteinID: XP_006691860
UniProt: G0S1F8
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVAVVRGDSKVTGTVTFEQESESSPTIITWDITGHDPNAKRGMHIHTFGDNTNGCTS
AGPHFNPHGKTHGAPTDENRHVGDLGNIETDANGNSKGTMTDHLVKLIGPESVIGRTVVV
HAGTDDLGKGGNEESLKTGNAGPRPACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggccgtcgctgtcgtccgtggtgactctaaggtcactggtactgtcaccttt
gagcaagagtccgagtcgtcgcccaccatcatcacctgggacatcaccggccacgacccc
aacgccaagcgtggcatgcacatccacaccttcggcgacaacaccaacggctgcacctct
gctggccctcacttcaacccccatggcaagacccacggcgccccgaccgacgagaaccgc
catgtcggcgaccttggcaacatcgagaccgatgccaacggcaactccaagggcaccatg
actgaccatctcgtcaagctgattggtcctgaaagcgttattggccgcactgtggttgtt
catgctggcactgatgacctcggcaagggcggcaacgaggagtcgcttaagaccggcaat
gctggcccgcgccctgcttgcggcgttattggcattgcccagtaa

DBGET integrated database retrieval system