KEGG   Chaetomium thermophilum: CTHT_0020730Help
Entry
CTHT_0020730      CDS       T03100                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00500  Starch and sucrose metabolism
cthr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTHT_0020730
Enzymes [BR:cthr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CTHT_0020730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18256111
NCBI-ProteinID: XP_006692547
UniProt: G0S3E5
LinkDB All DBs
Position
Unknown
AA seq 663 aa AA seqDB search
MRKLTANSVLQLKIASLMQVAPKLTAPDYHDYIQLEKLIKDKTHQSSQGLAGAIPQTLSL
EKWIKTERAIALEGVLDNIGANGTKVAGAGRGLVIASPSKSNPDYFYTWTRDSALTFRTI
IDDFLFGNKALQPHIENYIYSQAILQTVSNPSGSLLPNGAGLGEPKFNADGSRYNGNWGR
PQRDGPPLRAISLIQYSNYLISQEQKERVKREIWPIISNDLNYVGQYWNATTFDLWEEVS
GASFFTTQSQYRALIEGSTLAKSLNLSCPACSQAPQILCLLNSYWNGAYYTANFITSTAG
QPTGRVGIDANTILGPIMAFDPNASCNSPTLQPCHPKSLANFKAVVDTFRTLYPINEGIP
VGKGIALGRYPEDTYFGGNPWYLIVHGAAEFLYDVALSWSRQGQITITSTSLPFFKDLYP
SAKIGTYSKSHPTYHALAKAVHAYADSFIEVSKKYTPSNGMQAEQFLRISPGTPTSAANL
TWSFASFISMTHRRDGHLPASWVPTGRNAPVLPQICTPSDGSFIGTFAPATEAGAPNIKI
PCLTTVRFMVDAPTYYGENVFITGSTPTLGNWDVSKAYPLLSSNYTAERPLWWADVLLEF
EEGFKGGEVRYKYARQQDCGQDWIVEQDERVVTVPGCKVGGSGVVDVVVEEVFNGDGGTP
GGC
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaattgactgccaattcagtcctccagttgaagattgcgtccctgatgcaggtg
gctcccaagctcacagccccggattatcacgattacatccagctggagaaactcataaag
gacaaaactcatcaatcttctcaggggctggcaggagctatccctcagactttgtccctt
gaaaaatggatcaagaccgagcgagcaattgccctggaaggagtcctcgacaatattggc
gccaatggtaccaaggttgctggagcaggacgcggtctcgtcatcgccagtccatcaaag
tcaaatcctgactacttctacacttggactcgcgactctgccctcactttccggaccatc
atcgacgacttcctctttggaaacaaggcccttcagccacacatcgagaactacatctac
tcccaggctatcctccaaacggtcagcaacccatcaggctcacttctccccaacggtgct
ggtctcggcgagcccaagttcaacgctgatgggtcgagatacaatgggaactggggtcgg
cctcagagagacggtcctccattgagggctatctctctcatccagtatagcaactatctt
atctcccaagagcagaaggagagggttaagagggagatctggccaatcattagcaatgat
ctgaactatgttgggcagtactggaacgccacaacctttgacctttgggaggaagtttct
ggcgcttccttcttcaccacccaatcccaataccgcgccctcatcgagggctctaccctc
gctaagtccctcaatctctcttgcccagcttgctcgcaagcccctcagatcctctgcctg
cttaattcgtactggaacggcgcctactacacggcaaacttcatcacctccacggccgga
cagccaactggccgggtaggcatagatgcaaacacgatccttgggccgatcatggccttt
gaccccaatgcttcatgcaacagtcctacgctacagccatgccatccaaaaagcctggcc
aacttcaaagctgtcgttgacaccttccgcactctctatcccattaacgaaggcatccct
gtcggtaaaggcattgctttaggccgctaccccgaagatacctacttcggcggcaacccc
tggtacctaatcgtccacggggccgcagaatttctctacgacgtcgccctgtcctggtct
cgccaggggcagataaccattacttcaacctcacttcccttttttaaggacctctatccc
tctgccaaaatcgggacatattcgaagtctcatccaacttaccatgccttggcaaaagcc
gtgcacgcctacgccgactccttcatcgaggtctccaagaaatatactccctccaacggc
atgcaagcagagcaattcctccgcatttcccccgggactccaacctccgccgcaaacctg
acctggtccttcgcctccttcatttccatgactcaccggcgcgatggacatcttcctgca
agctgggtcccgactggtcggaatgcccctgttttgccccaaatttgtaccccaagcgac
ggctccttcattggcaccttcgctcccgcaaccgaggccggcgcacccaacatcaaaatc
ccctgcctcacaactgtccgcttcatggtcgacgcaccgacttactacggcgagaacgtc
tttattacgggcagcacgcccacactagggaactgggacgtgtctaaagcttatccctta
ctcagcagcaattatactgctgaacgcccgctctggtgggcagacgtcctgctggagttt
gaggagggctttaaggggggcgaggtgaggtataagtatgctagacagcaggattgtggg
caggattggattgttgagcaggacgagagggttgtgactgtgccggggtgtaaggttggg
ggttcgggggttgttgatgtggttgtggaggaggtgtttaacggggatgggggcactccc
ggcggttgctaa

DBGET integrated database retrieval system