KEGG   Chaetomium thermophilum: CTHT_0025760Help
Entry
CTHT_0025760      CDS       T03100                                 

Definition
(RefSeq) hypothetical protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cthr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CTHT_0025760
Enzymes [BR:cthr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CTHT_0025760
Chromosome and associated proteins [BR:cthr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CTHT_0025760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW Med26 Terpene_synth CENP-O
Motif
Other DBs
NCBI-GeneID: 18256614
NCBI-ProteinID: XP_006693036
UniProt: G0S676
LinkDB All DBs
Position
Unknown
AA seq 939 aa AA seqDB search
MEASDRASGPTAGSKSEERTKQNGPRSKKEDASDSSTSTGSKSASRSSSATTMSPDDAKP
ADDSALAQENGVAPKPSRKSSKLPPRNPPQLFNHLPDATEEACRTFQVISDCLYGSRNMG
SSDHDALDCDCAEDWRDGKNHACGEDSDCINRATKIECVIGDCNCGEGCQNQRFQRKQYA
KVSVIKTEKKGYGLRADTDLQPNDFIYEYVGEVINEPTFRSRMLKYDKEGIKHFYFMSLT
KNEFVDATKKGNLGRFCNHSCNPNCYVDKWVVGDKLRMGIFAARYIKAGEELVFNYNVDR
YGADPQPCYCGEPNCVGFIGGKTQTERATKLPLATIEALGIEDGDSWDTTVAKKPRKKKA
SETDEEYVNSLQPKALDEDGVNKVMATLMQCKEKWIAVKLLSRLQATQDDHLRHRVVRMH
GYQILKSTLNAFKHDNNVVLQVLDILYNLPRITKNKISDSNIEAVVQPLASSSDERVAFE
AKRLLEEWDKLETAYRIPRKKDGRVVSAIANSFEEERRSNREEPTKPADPLANVVIPTGP
RSNIPQRNANYYNGVRPRKPPTNLPEGWFVTVDKKTGKYYFYDVNGKVQWQRPTAPAITT
PKPSVKAQQDQKALQDIIDSLTKEPTPRQSAGHTPQRSSTPATEPKKEKWRSLPIEKQMK
IYENTLFPHVKYVMDKFHGKLPREDLKKFARDVNKKLVASDYKHNRVQDPTVPLSSKQAK
KVRKYVYDFFDRALQKYLEYQKRKAQYTSKEGMQSSQTEQNTATPTGTLGKDVDEVMSDV
EAPNSSPQSTSSAGRKRKRDDDQDGDHDMRSPADEDAATSSDPPSVKRIKEDDGTGNDVI
PSPPPPPPPPAEIPMTEEERSMREQEEALMRENEEAQRLEDEAKRKQLELQNGLAAAKNA
GIELGSASFTVSGEPMDVDNDGPPPQEQAQQQKQAVMSH
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaagtgaccgtgcttcaggaccgaccgcggggtcgaagtccgaggagagaaca
aaacaaaacgggccgcggtccaagaaggaggatgcgagtgattcatccacttcaaccggc
tcaaaatcggcctctcgatcttctagtgccacaacgatgtcccccgacgatgcaaagcct
gctgatgatagcgcgttggcccaagagaacggagtcgcgcccaagccgtcgcgaaagtca
tcaaaacttcctcctcgcaacccgccacagctattcaatcacctgccagatgctacagaa
gaagcatgtcgcacgttccaggtcatcagcgactgcctttacggctctcgaaacatgggg
tcatcggaccatgatgcgttagattgtgattgtgctgaggattggcgcgacggcaagaac
cacgcctgcggtgaagactcggactgtatcaatcgtgcgaccaagattgagtgtgttatt
ggcgactgcaattgtggcgaaggttgtcagaaccagcgcttccagcgcaagcagtatgcc
aaagtctccgtcatcaagactgagaagaagggctatggtctccgggcagacactgatcta
cagccgaacgactttatctacgagtatgtcggcgaagttattaacgagccgacgttccgg
agtcggatgctcaaatatgacaaagaagggatcaagcacttctacttcatgtcgttgacg
aagaatgagtttgtggatgcaaccaagaagggcaatctgggccgtttttgcaatcactca
tgcaaccccaactgctacgtcgacaaatgggtggttggagacaaactgcggatgggcatt
tttgccgcgcggtacatcaaggctggagaggagctggtgtttaactacaatgttgaccgc
tatggtgccgacccccaaccatgctattgcggtgagccgaactgtgtcggcttcattggt
ggcaagacgcagacagagcgtgcaaccaaattgccgctcgccaccatcgaggcgcttggc
attgaggatggtgacagctgggatacaactgtcgccaaaaagccccggaagaagaaggcg
tccgagactgatgaggaatatgtcaacagcttacagccgaaggcccttgacgaggatgga
gtcaacaaggtcatggccacactcatgcaatgcaaggagaaatggattgctgtcaaactt
ctctctcgccttcaggctactcaagacgatcacttgcgccatagagtggtgcggatgcac
ggctatcagatcctgaagagcacgctcaatgccttcaaacacgacaacaacgtggttttg
caggttctagacatcttatacaaccttccccgtatcactaagaacaaaatctccgactca
aacatcgaggcagttgtgcagcctcttgcctcatcatcggatgagcgtgtggccttcgaa
gccaagcggctgcttgaggaatgggacaagttggaaacagcttaccgcattccacgcaag
aaggacggccgcgtggtgtcagcgatcgctaattcattcgaggaagaacggcgtagcaat
cgcgaggagcccacaaagcccgcggaccctcttgcgaacgtggtgatcccgacaggtccc
cgcagcaacatccctcaacgaaatgccaactattacaatggagtgagacctcggaagccc
ccgaccaatttgccggagggctggtttgtcactgtggataagaagactggcaaatactac
ttttacgatgtcaatggcaaggttcagtggcaacgccccactgcccctgctatcacaacc
cccaagccatccgtcaaggctcagcaggaccaaaaagccctgcaggacatcattgatagc
ttaacgaaggagccaaccccgcgtcaatcagcaggtcatactccgcagcggtctagcact
cctgcaacggagccgaagaaggagaagtggcgttctctaccaatcgagaagcagatgaag
atctatgagaacacactctttcctcacgtcaagtatgtcatggacaagttccatggcaaa
ctgcccagggaagaccttaagaagttcgcgcgcgatgtgaacaagaagcttgttgcctcg
gattacaagcacaatagagtccaggacccgacggttcccctctcgagcaagcaggcgaag
aaggtccgcaagtatgtctacgacttctttgaccgcgcactgcagaaatacctcgagtat
caaaagagaaaggcacagtacacctcgaaggagggcatgcaatcttcccagacagagcag
aacaccgcgacgcccactgggactctgggcaaggatgtcgatgaggtcatgtccgatgtg
gaggcccccaacagcagccctcagagcaccagctcggccggacgcaagcgtaagcgcgac
gacgaccaggatggtgatcacgacatgcgctcccctgcagacgaggatgccgctacctca
tccgacccgccgtctgtgaaacgtatcaaagaagatgacggcactggcaacgatgtcatc
ccaagcccgcctccaccacctcctcccccggctgaaatccccatgactgaggaagagagg
tctatgcgcgagcaggaagaggctctaatgcgcgagaacgaggaggcccaacgtttggag
gatgaggcgaagaggaagcagctagagctgcagaacgggctcgcagctgccaagaacgct
ggtattgagctcgggtcagcgtcgtttaccgtgtctggtgagccgatggacgtggataat
gatgggccgccgccgcaagaacaggcacagcagcagaagcaagctgtgatgagccattga

DBGET integrated database retrieval system