KEGG   Chaetomium thermophilum: CTHT_0038040Help
Entry
CTHT_0038040      CDS       T03100                                 

Definition
(RefSeq) histone deacetylase-like protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cthr  Chaetomium thermophilum
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cthr03036]
    CTHT_0038040
Enzymes [BR:cthr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CTHT_0038040
Chromosome and associated proteins [BR:cthr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CTHT_0038040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl Draxin
Motif
Other DBs
NCBI-GeneID: 18257842
NCBI-ProteinID: XP_006694226
UniProt: G0S896
LinkDB All DBs
Position
Unknown
AA seq 1119 aa AA seqDB search
MARTSDAHATSTSRDDRQDHHNDLTESMEKLRINKTSPSAKTARPGRPGPVNSAAMNPLA
ENLPNTPRPGSAMRTPLRSASAAVKEPHSRSGTPTLVRKASMTSLHSVATTATTHGPSRR
ASIAHISSVAKSRSGTSPLRDISPEPIIIPTPHSVASAHFKAELDIHHGPEPTRRVETVV
ILQDACYGHRYSRPRASKSLLSTIVERPERIKACILGIAAAYVRLGERHQDGAFPIHPDS
DPATLPTIPFRIQKSFRRVPLTSQVVTNVHGVKWMEELRHMCDTAETKLASGGKELERPD
MDRGPNAGEPQAFHEGDLYLCEDSRDALEGALGGVCDAVDIVFNPHGPQRAFVAIRPPGH
HCSASHPSGFCWINNVHVGIMHAILAHGLTHAAIIDFDLHHGDGSQAIAWQHNTRTINSA
KNAALWKKTSIGYFSLHDINSFPCETGDEEKVRNASICIDNAHGQTVWNVHLEPWKTESD
FWTIYNTKYSALLERARGYLKAQTEKLRAAGLNSKAAIFISAGFDASQWEDPGMQRHNVN
VPTDFYAKFTRDIVRIAAEEGTSVEGRIISVLEGGYSDRALCSGVFAHLCGLAGDGASNE
PRSRPASVDFSQLPQGTPVPTSMPLRGRKDSSASERGSRRYEPSWWSAAELERLEVTVAT
PAPQPRVIRNITPPTYSSPTQASIAKAKAPPRFPSAGLASNGAEIRSLPPSSPCLDIPWT
IATHELSKLLIPTDRQTNSCTAEELNAEATRLRRERQIALGTLAPPPQPAVPPTVPEEGR
APTRTGLRERKPKVAEDAIGGDVESKSRRQTVSGAGDLSGKMMRATSRRLSAASAVASSS
EVPARPPSSGSVSVAGSNGLTVKKTRSTATLRKEPSVASLKKDSTASTTAARTTIKVKKT
PAVNGTTSDKKDGGEEVDKIAGDMKRIKITVIQKAQKDARERERLVREKLAQAQGQRMDV
PASESIAEEEEEEQASTPQAQAPPAQPLPSPTPSLSLSPCSLAPGQTQSFLYQQQQVIHD
QPSQVQTQEPGLASPPTSAPRTVPSSPASSVEPACSASISPGTDGQPKRNKLPDWPPKPL
NQQASLPPKPQPMPIKRENLPIFSSKGHIPFAPRPEEQK
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaccagcgatgcgcacgcgacgtcgacgtccagggatgacaggcaggaccac
cacaatgacctgaccgagtccatggagaaactcaggatcaacaaaacatctccctctgcg
aagaccgctcgtcctggccgtcctggccctgtcaattccgctgcgatgaatcccctcgcc
gaaaatctgcccaataccccccgaccaggcagcgccatgcgaaccccccttcgcagcgct
tcagctgccgtcaaggagccacactcgcgatcgggaacacctacgctggtacggaaagcg
tccatgacctctctgcactcggttgcaaccacggcaactacccacggcccgtcgcgccgc
gcgagcatcgcccatatctcgtcggtggccaaatctcggtcgggcacgtcgccgttgaga
gacatctcgcccgagcccatcatcattcccactccgcattccgtcgcaagcgcccacttc
aaggctgagctcgacatccaccatgggcccgagccgactcgtcgcgtcgagaccgtcgtc
atcctgcaggacgcctgctacggccatcgctactcgcgcccccgtgcatccaagtcgctc
ctcagcaccatcgttgagcgcccagagcgcatcaaggcctgcatcctcggtatcgccgct
gcttacgttcggttgggcgagcggcaccaggatggtgcattccccattcaccccgatagc
gatcctgccacgctgcccacgattccgttccgtatccagaagtcgttccgtcgagtgccc
ctgacctcgcaggttgtgacaaacgtacacggtgtcaagtggatggaggagctcaggcat
atgtgtgatacggcagagacgaagctggcatcgggaggcaaagaactggagcgacccgac
atggaccgcggcccgaacgctggagagccgcaggcatttcatgagggagatttgtacctg
tgtgaggactctcgggacgctctggaaggtgcccttggcggcgtctgcgatgctgtcgat
atcgtcttcaatcctcacggcccgcagcgtgctttcgtcgccatccggccgccaggccac
cactgctccgcgtcacatccgtcgggcttctgctggatcaacaacgtgcatgtcggcatc
atgcatgctatcctggcccatggcctgacccacgctgccatcatcgacttcgacctgcac
catggtgacggctcacaggctattgcctggcaacacaacacacggaccatcaattccgct
aagaacgcggcgctgtggaagaagacgtccatcggctacttcagtttgcacgacatcaat
tcgtttccgtgcgagacgggcgatgaggagaaggttaggaacgccagcatctgcatcgac
aacgcgcacggtcagaccgtttggaatgtgcacttggagccgtggaagaccgagtccgac
ttctggaccatctacaacaccaaatattctgctctacttgagcgtgcgcgcggctacctt
aaggctcagaccgagaagcttcgcgcagccgggctcaactccaaagctgccatcttcatc
tcagccggctttgatgccagccagtgggaggaccctggcatgcagcgccataacgtcaac
gtgcccacggatttctatgccaagtttacccgcgacatcgtccgcatcgccgctgaggag
ggcaccagcgttgagggccgcattatcagcgtcctcgagggcggctacagcgaccgggcc
ctctgctccggcgtttttgcccatctctgcggcttggccggtgacggagccagtaacgag
cctcgttctcgtcccgccagcgtcgatttctcgcagttgccgcaaggaacccccgtccca
acttctatgccgctgcgaggacgtaaggactcctcagctagcgagcgcggatcccgtcgg
tacgagccctcgtggtggtctgccgccgagttggagcgtctcgaggtcaccgtggccaca
ccagctcctcagccccgcgtcattcgtaacatcaccccgccgacatactcgtccccgacg
caagcgtctatcgcgaaagccaaggccccgccacgtttcccttcggctggtcttgcttcc
aacggcgccgaaatccgttcgcttcccccctcctcgccatgcctagacattccttggacc
atcgccacgcacgagctcagcaagctcctcatcccgactgatcggcagaccaatagctgc
accgccgaagagcttaatgctgaagcgacgaggctgcgccgtgagagacagatcgccctt
ggcacgcttgctcctccgccgcagcctgctgtgccgccgactgtgcctgaagagggccga
gcaccgacacggacgggcttgcgggagaggaagccaaaggttgctgaggatgctattggt
ggtgatgtggagtccaagtcaaggaggcagacggtatctggggcaggagatttgtcaggg
aagatgatgagagcgactagtcgccggcttagtgcggcatcggctgttgcgtcgtcgtcg
gaggtacctgccaggccaccgtcgtcggggagtgttagtgtcgcaggttccaacggactg
acggttaagaagacgaggtcaacggccacactgaggaaagaaccttcggtggcatcgctg
aagaaggattctactgcaagcacgacggctgctcggacaacaatcaaggtgaaaaaaact
cccgctgttaacggtaccacatctgataagaaagacggtggcgaggaagtcgacaagatc
gccggtgatatgaagagaatcaaaatcaccgtcatccaaaaggcccagaaggatgcccgc
gagcgggagcgccttgtccgcgagaagcttgcccaagctcaaggccagcgtatggatgtc
ccagcctccgaatcgattgcggaagaggaggaggaggagcaagcatctactccacaggct
caagccccacctgctcaaccactcccctccccgacgccatccctctctctctcaccgtgc
tccctcgcaccggggcagacccagtctttcctgtaccagcagcagcaggtcattcatgac
cagccgtcccaggtgcagacccaagaaccgggtctcgcatcccctcccacaagcgccccg
cgtacggtcccgtcctcgccagccagcagcgtcgagcctgcctgtagtgcctctatctcc
cctggcacggatgggcagccgaagaggaataagcttcctgactggccgcccaagccgctt
aatcagcaggcttcgttgccgccgaaaccccagccaatgccgattaagagggagaatttg
ccgattttctcaagtaaggggcatatcccttttgcgccgaggcctgaggagcagaagtaa

DBGET integrated database retrieval system