KEGG   Chaetomium thermophilum: CTHT_0046180Help
Entry
CTHT_0046180      CDS       T03100                                 

Definition
(RefSeq) isocitrate dehydrogenase NADP+-like protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00020  Citrate cycle (TCA cycle)
cthr00480  Glutathione metabolism
cthr01100  Metabolic pathways
cthr01110  Biosynthesis of secondary metabolites
cthr01130  Biosynthesis of antibiotics
cthr01200  Carbon metabolism
cthr01210  2-Oxocarboxylic acid metabolism
cthr01230  Biosynthesis of amino acids
cthr04146  Peroxisome
Module
cthr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cthr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTHT_0046180
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CTHT_0046180
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CTHT_0046180
Enzymes [BR:cthr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CTHT_0046180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 18258656
NCBI-ProteinID: XP_006694998
UniProt: G0S9K2
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MSSAASSALRASLLRSSASSRSAAAAAAAARPAFSNLRASPVSVSARAAPVYVFSQHFIS
RRTMATDAPIKKIKVKNPIVELDGDEMTRVIWKDIKEKFIYPYLDVDLKYYDLGIEYRDQ
TNDQVTIDAAEAIKKYSVGVKCATITPDEARVKEFNLKQMWLSPNGTIRNILGGTVFREP
IVIPRIPRLVPGWKKPIIIGRHAFGDQYRAKDTVIPGPGKLKMVYVPEGGEPQEIDVFEF
KNGGGVAQTQYNTDESIRGFAHASFKLALDKGLPLYMSTKNTILKRYDGRFKDIFQELYD
NEYKPLFEAKGIWYEHRLIDDMVAQMIKSSGGYVMALKNYDGDVQSDVVAQGFGSLGLMT
SVLITPDGKTFESEAAHGTVTRHYREYQKGKETSTNPIASIFAWTRGLVQRGKLDGTPEV
VAFAEALEQACIDTVDIDGIMTKDLALACGKTAREDYVTTREYMDAVDKRLRKSLQEKLQ
KL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgctgcttcttcggccttgcgtgcctctcttcttcgctcctcagcctcgtct
cgctctgctgctgctgctgctgctgctgctcgcccggccttcagcaacctccgtgcctcg
cccgtctctgtctctgctcgcgccgctcctgtctacgtcttttcccagcatttcatcagt
cgccgcaccatggctaccgacgcccccatcaagaagatcaaggtcaagaaccccatcgtc
gagctcgatggcgatgagatgacccgcgtcatctggaaggacatcaaggagaagttcatc
tacccttatctggatgtcgatctcaagtactacgacctgggcatcgagtaccgcgaccag
accaacgaccaagtcaccattgatgccgctgaggccatcaagaagtactcggttggcgtc
aagtgcgccaccatcacccccgatgaggctcgtgtgaaggagttcaaccttaagcagatg
tggctctcgcccaacggcaccatccgtaacattctgggtggcaccgtcttccgtgagccc
atcgtcatcccccgcattcctcgcctggttccgggctggaagaagcccatcatcattggt
cgccatgccttcggtgaccagtaccgggccaaggataccgtcatccccggccccggcaaa
ctgaagatggtctacgtccctgagggcggcgagccccaggagattgacgtcttcgagttc
aagaacggcggtggtgttgctcagactcaatacaacactgacgagagcatccgcggcttc
gcccacgccagcttcaagctcgctttggataagggcctgcccctgtacatgagcaccaag
aacaccatcctgaagcgctacgacggccgcttcaaggacatcttccaggagctgtacgac
aacgagtacaagcccctgttcgaggccaagggtatctggtacgaacaccgcctcattgac
gacatggtcgcccagatgatcaagagcagcggtggctacgtcatggccctgaagaactac
gacggcgatgtccagtccgacgtcgttgctcagggctttggctccctcggcctgatgacc
tcggtcctcattacccccgacggcaagaccttcgagtctgaggccgctcacggcaccgtc
acccgccactaccgcgagtaccagaagggcaaggagacctcgaccaaccctattgcctcc
atcttcgcctggacccgcggtctcgtccagcgcggcaagctcgacggcacccccgaagtc
gtcgccttcgccgaggccctcgagcaggcctgcattgacaccgtcgacatcgacggtatc
atgaccaaggatctggctctcgcctgtggcaagactgcccgcgaggactacgtcaccacc
cgcgagtacatggatgctgtcgacaagcggctgcgtaagagcctgcaggagaagctccag
aagctttaa

DBGET integrated database retrieval system