KEGG   Chaetomium thermophilum: CTHT_0057970Help
Entry
CTHT_0057970      CDS       T03100                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00020  Citrate cycle (TCA cycle)
cthr00190  Oxidative phosphorylation
cthr01100  Metabolic pathways
cthr01110  Biosynthesis of secondary metabolites
cthr01130  Biosynthesis of antibiotics
cthr01200  Carbon metabolism
Module
cthr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cthr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cthr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTHT_0057970
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CTHT_0057970
Enzymes [BR:cthr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CTHT_0057970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 18259835
NCBI-ProteinID: XP_006696117
UniProt: G0SCP6
LinkDB All DBs
Position
Unknown
AA seq 649 aa AA seqDB search
MASSMAWRRLASTPALARAARPSVRAFSTTRPAARVIVPNGVLRAKEASPHVSNKYAVID
HEYDAVVIGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDW
RWHMFDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGKIYQRAFGGQSKE
YGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFAIDLLMQDGECRGVLAYNQ
EDGTLHRFFANNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTG
IYGAGCLITEGARGEGGFLLNAKGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGP
EKDHIYLQLSHLPAEVLKERLPGISETAAIFAGVDVTKQPIPVLPTVHYNMGGIPTRYTG
EVLTIDENGNDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDKFTPG
AKLKPVEADIGHESIEVLDKIRTSDGPKSTAEVRLAMQKTMQREVSVFRTQESLDEGVRQ
IKEIDQMFNQIGIKDRSMIWNSDLVETLELRNLLTCATQTAHAAAARKESRGAHAREDYP
ERDDENWMKHTLSWQKQPHGPVELKYRRVITNTLDENECKPVPPMKRVY
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctcaatggcttggagacgtctcgcctcgacgccggcgctcgcgcgcgccgct
aggccctcggtccgggccttttccaccacgcggccggccgcccgcgtcattgtcccgaat
ggcgtgctccgcgcgaaggaggcgtcgccgcacgtcagcaacaagtacgccgtcatcgac
cacgagtacgatgcggttgtcatcggtgccggcggtgccggccttcgtgctgctttcggt
ctggctgaggccggcttcaacacggcttgcatctccaagctgttccccacgcggagccac
actgttgctgcccagggcggtatcaatgccgctctcggaaacatgcatgaggacgactgg
cggtggcacatgttcgataccgtcaagggctccgactggctcggtgatcaggatgccatc
cactacatgacgcgcgaggcccctgcctccatcatcgagctcgaaaactatggctgcccc
ttctcaagaaccgaggacggcaagatttaccagcgtgccttcggtggccagtccaaggag
tacggcaagggcggccaggcctaccgctgctgcgctgctgctgaccgtaccggccacgct
cttctgcacaccctctatggccagtccctgcgccacaacaccaactacttcatcgagtac
ttcgccatcgacctgctcatgcaggacggcgagtgccgcggtgtcctggcctataaccag
gaggacggcacgctgcaccgcttctttgctaacaacaccgttctggccaccggcggctac
ggccgtgcctacttcagctgcacttcggcccacacctgcaccggtgacggcatggccatg
gttgcccgtgccggcctccccaaccaagatctcgagttcgtgcaattccatcccaccggt
atctatggcgctggctgcctgatcaccgagggtgcccgtggtgagggtggcttcctcctc
aacgccaagggtgagcgcttcatggagcgctatgctccgaccgccaaggatcttgcctcc
cgtgatgtcgtctcccgctccatgaccttggaaatccgcgagggccgcggtgttggccct
gagaaggaccacatctacctgcagctcagccacctgcctgctgaggtcctcaaggagcgt
ctgcccggtatctcggagacggctgctatcttcgctggtgtcgacgtcaccaagcagccc
atccctgtcttgcccaccgtccactacaacatgggtggtatcccgactcgctacactggt
gaggtgctcaccatcgacgaaaacggcaacgacaaggttgttcctggcctgttcgcttgc
ggtgaggctgcttgcgtctctgtccacggtgccaaccgcctgggtgccaactcgcttctc
gacttggttgtcttcggccgtgccgtctcacacaccatccgcgacaagttcactcctggc
gccaagttgaagcctgtcgaagccgacattggccacgagtcgatcgaggtcctcgacaag
atccgcacctcggacggtcccaagagcactgctgaggtccgtctcgccatgcagaagacc
atgcagcgcgaggttagcgtcttccgcacccaggagagcttggacgagggtgtccgccag
atcaaggagatcgaccaaatgttcaaccagatcggcatcaaggaccgcagcatgatttgg
aactcggatctcgtcgagaccctggagctccgcaacctgctcacctgcgctacccagacc
gcccacgccgccgctgcccgcaaggagtctcgtggcgctcacgcccgcgaggactacccc
gagcgcgacgacgagaactggatgaagcacactctcagctggcagaagcagcctcatggc
cctgtcgagctcaagtaccgccgcgtcatcaccaacaccctggacgagaacgagtgcaag
cctgtgccgcccatgaagcgcgtgtactaa

DBGET integrated database retrieval system