KEGG   Chaetomium thermophilum: CTHT_0058600Help
Entry
CTHT_0058600      CDS       T03100                                 

Definition
(RefSeq) hydrolase-like protein
  KO
K20813  thymine-DNA glycosylase [EC:3.2.2.29]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CTHT_0058600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cthr03400]
    CTHT_0058600
Enzymes [BR:cthr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.29  thymine-DNA glycosylase
     CTHT_0058600
DNA repair and recombination proteins [BR:cthr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CTHT_0058600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 18259898
NCBI-ProteinID: XP_006696180
UniProt: G0SCW4
LinkDB All DBs
Position
Unknown
AA seq 324 aa AA seqDB search
MASETTEETRPPPSFKGRLQLESFMYNGSGLRRSPRLSGALSYSAPPTPSAAQPNLSSKR
KEPPSQNSQDGASDGDGNGTSSSSSASNSQAKRKRVRQPSSYAPPSTYAHLPPLPDSLGP
NLLVLFVGLNPGIETARSGHAYAHPTNLFWRLLYSSGVTPRLCSPTEDRQMPALYSLGLT
NIVSRPSRNGAELSKQEMDAGVDILEKKTRIWRPEVVCIVGKSIWESIWRVKHGKAIKPA
EFRYGWQDETENMGVVGPQGQKEEEKEEGVEYSPDWKGARVFVATSTSGLAATLKPKEKE
AIWKELGDWVVKRRAERVAAADRS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgagacgacagaagagactcgaccccctcccagctttaagggccgtctccag
ctcgaaagcttcatgtataacggtagcggattgcggagaagcccccgtctctctggagcc
ttgtcatacagcgcacctccgactccgtcagcggctcaacccaatttgtcgtccaagcgc
aaagagccaccatcacagaactcacaggatggagccagcgacggcgatggcaacggtact
tcctcttcctcctctgccagcaattctcaagccaaacgcaagcgtgtccgccagccatcc
tcttacgcccctccatctacctatgcccatctccctcctcttcctgactctctcgggccc
aacctcttagtcctcttcgttggcttaaacccgggcattgaaacagctcgctcgggacac
gcctacgcccatccaaccaaccttttctggaggcttctctactcgtcgggcgtcacgcct
cgactatgctcacccaccgaagaccggcaaatgccagcgctgtactcgttggggctgaca
aatatcgtctcaaggcccagtcggaatggcgccgagctgagtaaacaagaaatggatgct
ggcgtggacatattggagaaaaaaaccaggatatggaggccagaggtagtgtgtattgtt
gggaaaagtatctgggagagtatttggagagtcaagcatggaaaggctataaagcctgcc
gaattccggtatggatggcaagatgagacggagaatatgggcgtggtaggtccccaaggg
cagaaagaagaggagaaggaggagggagtggagtactcaccggactggaagggggcgagg
gtctttgtggcgacaagcacgagtgggttggcagctacgttgaaacccaaggagaaggag
gcgatctggaaagaattgggagactgggtcgtcaaacgacgggcagagcgagtagcagcg
gcagacagatcctga

DBGET integrated database retrieval system