KEGG   Chaetomium thermophilum: CTHT_0068710Help
Entry
CTHT_0068710      CDS       T03100                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CTHT_0068710
Enzymes [BR:cthr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CTHT_0068710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 18260909
NCBI-ProteinID: XP_006697158
UniProt: G0SH51
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MVKLNNLLQYFSLGQSSFQSTMLASNFTAVAIAVHTLPVLPYSYSALEPYISSQVMELHH
SKHHQAYVDNLNAALSSYVTALLNNDIPAQIRLQSIIRFNGGGHINHSLFWRNLAPSETP
ETDPVASAPRLVNEIERTWGGLDEFKETFAQTALGIQGSGWCWLVGKQNGRGGLQLAIVT
TKDQDPIVDEGMRPLLGVDMWEHAYYLQYLNGKTKYLENIWNVINWKTAEERFLGASKEE
AF
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagctcaacaacctacttcagtacttctctttgggccagtcatccttccaatcc
actatgttggccagcaattttactgctgtcgcaattgctgttcatacgcttcctgttctc
ccttattcttactccgccttggagccttacatttcctcccaggtaatggagctgcaccac
tccaagcaccaccaagcctacgtcgacaacctcaacgcggccctttcatcctacgtcact
gcccttttgaacaatgacattccagcccaaatccgtcttcagagtattatccgcttcaat
ggaggaggacacataaaccactccttgttctggcgaaatctggctccttcagaaacgccc
gaaaccgatcccgttgcttcagcaccacggctggttaatgagattgagagaacttgggga
ggtctagacgagttcaaagaaacatttgcacaaactgcattgggtatccagggcagtggg
tggtgttggctggtggggaagcagaacggtcgtggcggattgcagttagccatagtgaca
acaaaggaccaggaccctattgtagatgaggggatgaggccgctgttgggagtggacatg
tgggaacacgcttattacctgcagtacctcaacggaaaaacgaagtatctggaaaacatt
tggaatgtcatcaattggaagacagctgaagagcggtttcttggtgcttccaaagaagaa
gccttctga

DBGET integrated database retrieval system