KEGG   Chaetomium thermophilum: CTHT_0073860Help
Entry
CTHT_0073860      CDS       T03100                                 

Definition
(RefSeq) dehydrogenase-like protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
cthr  Chaetomium thermophilum
Pathway
cthr00040  Pentose and glucuronate interconversions
cthr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CTHT_0073860
Enzymes [BR:cthr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     CTHT_0073860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 UDPG_MGDP_dh_N HI0933_like Methyltransf_25 Pyr_redox 2-Hacid_dh_C PALP AdoHcyase_NAD Prot_ATP_ID_OB Shikimate_DH Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 18261424
NCBI-ProteinID: XP_006697640
UniProt: G0SHY8
LinkDB All DBs
Position
Unknown
AA seq 383 aa AA seqDB search
MAAGKSNLSFVLKKPNEVSFEERPVPKLQSPHDVLVAVNYTGICGSDVHYWVHGAIGHFV
VKDPMVLGHESAGTVVEVGSAVTSLKPGDRVALEPGYPCRRCNNCLSGKYNLCPDMVFAA
TPPYDGTLTGFWTAPADFCYKLPDNVSLQEGALIEPLAVAVHIVRQARVSPGQSVVVMGA
GPVGLLCAAVARAFGASKVVSVDIVQSKLDFAKKFAATHTYMSQRVSAEENAKNLLKAAD
LPGGADVVIDASGAEPSIQTSLHVVRMGGTYVQGGMGKADITFPIMALCLKEVTARGSFR
YGSGDYKLAIELVGSGKVDVKQLINGVVPFEKAEDAFKKVREGQVIKILIAGPNEKVENG
GLDTTVDEKKLKEAKVNGSTGCC
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggcaagtctaacctctccttcgtcctgaagaagcccaacgaggtctccttc
gaggagcgccccgttcccaagctccaatccccccacgatgtcctcgtcgccgtcaactac
acgggcatctgcggcagcgacgtgcactactgggttcacggcgcgatcggccacttcgtg
gtcaaggacccaatggtgctgggccacgaatcggccggcacggtcgtagaggtcggcagc
gccgtgacctcgctcaagccgggcgaccgcgtcgccctggagccgggttacccctgccgc
cgctgcaacaactgcctctcgggcaagtataacctctgcccggacatggtctttgccgcc
accccgccctatgacggcaccctcaccggcttctggaccgcccctgccgacttctgctac
aagctgccggacaatgtttccctgcaggagggcgcgctgatcgagcctctggccgtggcc
gtgcacatcgtgcgccaggcgcgcgtctcgcccggccagtccgtcgtcgtcatgggcgcc
ggccccgtcggtctgctgtgcgcggccgtcgcccgcgcctttggcgccagcaaggtcgtc
tcggtcgatatcgtgcagagcaagctcgactttgccaagaagtttgccgctacccacacg
tacatgtcgcagcgcgtatcggccgaggagaacgcgaagaacctgcttaaggccgccgac
ctgcccggcggcgcggacgtcgtcatcgacgcctccggcgccgagccctcgatccagacc
tcgcttcacgtcgtgcgcatgggcggcacctacgtccagggcggcatgggcaaggctgat
atcaccttccccatcatggcgctgtgcctgaaggaggtgacggctcgcggttccttccgc
tatggcagcggtgactacaagctggcgatcgagcttgtcggatcgggcaaggtcgacgtt
aagcagctgatcaatggcgttgtgccctttgagaaggccgaggatgccttcaagaaggta
cgcgagggccaggtcatcaagatcctgattgctggcccgaacgagaaggtcgagaacggt
gggctggataccactgtggatgagaagaagctgaaggaggcgaaggttaacgggtcgact
gggtgctgctga

DBGET integrated database retrieval system