KEGG   Cupriavidus taiwanensis: RALTA_A0244Help
Entry
RALTA_A0244       CDS       T00702                                 

Gene name
dacC
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase; penicillin-binding protein 6a
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00550  Peptidoglycan biosynthesis
cti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RALTA_A0244 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cti01002]
    RALTA_A0244 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cti01011]
    RALTA_A0244 (dacC)
Enzymes [BR:cti01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RALTA_A0244 (dacC)
Peptidases and inhibitors [BR:cti01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   RALTA_A0244 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:cti01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   RALTA_A0244 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: CAP62914
UniProt: B2AGL5
LinkDB All DBs
Position
1:245706..246905
Genome map
AA seq 399 aa AA seqDB search
MLNRATTRLSSAFAPAAIAAAVVLAAAPAAVLAQGVPMPQVAAKSWMLYDVTSGQALASQ
NADARIEPASLTKLMTAYLAFEALKEKRLTLDQAVVPTNLVLKVKSDESRMFIEPNKPVT
VQDLLLGLIVQSGNDAALALAEAVGGSEEGFVAMMNREAQRMGMKNTHFTNTDGIPDPNH
YTTAVDLATLTTRLIKDFPEYYSMYSQKEFTYNKIRQPNRNRLLYIDSTVDGVKTGHTKS
AGYCLISSAKRPLANVPDGSRRLISIVIGTTTEQVRTQESLKILNYGFQFFDTLRLYDKG
QVLATPDIYKGKSGTVKIGVQNETFVTVPKGTGGRLKPVLERQELLIAPISAGQQVGMVK
LMDGTNKVAEFPVVALEEVPEAGFFGRLWDTIRLWFKRK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatagagccacgacacgcctttcgtccgcctttgctcccgccgccatcgccgcc
gctgtcgtgctggccgccgcgcccgccgccgtactggcgcagggcgtgccgatgccgcag
gtcgcagccaagtcgtggatgctgtatgacgtcaccagcggccaggccctggcttcgcag
aacgccgatgcgcgcatcgagccggcctcgctgaccaagctgatgaccgcctacctggcg
ttcgaggcactcaaggaaaagcgcctgacactggaccaggccgtggtgccgaccaacctg
gtgctcaaggtcaaaagcgacgagtcgcgcatgttcatcgagcccaacaagccggtcacc
gtgcaggacctgctgctgggcctgatcgtgcagtcgggcaacgacgccgcgctggcgctg
gccgaggccgtgggcggctcggaagagggcttcgtcgcgatgatgaaccgcgaggcccag
cgcatgggcatgaagaacacccacttcaccaataccgacggcatccccgaccccaaccac
tacaccaccgcggtcgacctggcgacgctgaccacgcgcctgatcaaggacttccccgag
tactacagcatgtactcgcagaaggagttcacctataacaagatcaggcagcccaaccgc
aaccgcctgctgtacatcgactcgaccgtcgacggcgtcaagactggccacaccaagtcc
gccggctattgcctgatctcgtcggccaagcggccgctggccaacgtgccggacggctcg
cgccgcctgatctcgatcgtgatcggcaccaccaccgaacaggtgcgcacccaggaaagc
ctgaagatcctcaactacggtttccagttcttcgacaccctgcgcctgtacgacaagggc
caggtgctggctacgccggacatctacaagggcaagagcggcacggtcaagatcggcgtg
cagaacgagaccttcgtcaccgtgcccaagggcaccggcggacgcctcaagcccgtgctg
gagcgccaggaactgctgatcgcgccgatctcggcgggccagcaggtgggcatggtcaag
ctgatggacggcaccaacaaggtggccgaattcccggtggtggcgctggaagaggtgccc
gaggccggcttcttcggccgcctgtgggacaccatccgcctgtggttcaagcgcaagtga

DBGET integrated database retrieval system