KEGG   Cupriavidus taiwanensis: RALTA_A1551Help
Entry
RALTA_A1551       CDS       T00702                                 

Definition
(GenBank) putative GLUTATHIONE S-TRANSFERASE PROTEIN, GST superfamily, Beta family.
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RALTA_A1551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cti02000]
    RALTA_A1551
Enzymes [BR:cti01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RALTA_A1551
Transporters [BR:cti02000]
 Other Transporters
  Pores ion channels [TC:1]
   RALTA_A1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: CAQ69498
UniProt: B3R189
LinkDB All DBs
Position
1:1618505..1619110
Genome map
AA seq 201 aa AA seqDB search
MTMTLYYNPQSRASVARWMLEEVGADYALQHLDIAKGESRAPAFLAINPMGKIPTLVLDD
GTVLTENGAIIAWLADAYPKAGLMPPAGSSARGTVLRWLFFCGSCFEPALTDRMMRAQAP
LPKQTVGWGDYDEVIDAIEKALSPGPFVLGDSFSAADVYLGASLAWAGQFGAPRVRESRR
IQDYVGRITARDAFVRAQTAQ
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacgctttactacaacccccagagccgcgcgtcggtggcgcgctggatgctg
gaggaggttggcgccgattacgcgttgcagcacctcgatatcgccaagggagaaagccgg
gcgccggctttcctggcgatcaatccgatgggcaagatccccacgctggtgctggacgat
ggcaccgtgctgaccgagaacggcgccatcatcgcctggctcgccgatgcctatccgaaa
gccggactgatgccgccggcgggctcgtccgcgcgcggcacggtgctgcggtggctgttc
ttctgcggcagctgcttcgagcccgcgctgaccgaccgcatgatgcgtgcccaggcgccg
ctaccgaagcaaaccgtcggctggggcgactatgacgaagtcatcgacgccatcgaaaaa
gccctgtccccgggccccttcgtgctcggcgacagcttcagcgccgccgacgtctacctg
ggcgcgtcgctggcgtgggcggggcagttcggcgcgccgcgggtccgcgaaagccgccgc
atccaggactacgtcgggcgcatcacggcgcgcgacgctttcgtacgcgcgcaaaccgcc
cagtga

DBGET integrated database retrieval system