KEGG   Cupriavidus taiwanensis: RALTA_A2011Help
Entry
RALTA_A2011       CDS       T00702                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase, FAD/NAD(P)-binding protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00564  Glycerophospholipid metabolism
cti01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    RALTA_A2011 (glpD)
Enzymes [BR:cti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RALTA_A2011 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like Pyr_redox_2 FAD_binding_3 GIDA NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: CAQ69952
UniProt: B3R1V5
LinkDB All DBs
Position
1:2138462..2140066
Genome map
AA seq 534 aa AA seqDB search
MHSLPTPIQPPSRAALLATLEREPRWDVIVIGGGATGLGTAVDAASRGYRTLLVEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLARNAPHLVWPLGFVVPAYQMFDQP
FYGIGLKLYDMLAGSLNLSGSRWLNHREVLAAAPNLAEHVGGRPLRGGNLYFDGQFDDAR
LAVALMRTLFDVGGTALNYLRATGLSQQGGVISGVTVQDVLGGGTYRLRADCVINATGVW
VDAIRQMEDGHARTMVAPSQGVHLTLPRSFLPGERAILIPKTDDGRVLFVVPWNGHTIVG
TTDTPRRDLPLEPDAGADDVDFILETASRYLARDPTRADVTSVWAGLRPLVRATGEASTA
SLSREHTILVSRAGLITVTGGKWTTYRKMAEDVIETAIQRQMVRAAPCMTAELPLHGAAG
LPTDLPPPDSGSPDRYYGNELGLLRALPGHDRMLAGASGLTEAHVRFAARHELARRVEDV
LARRNRALFLDARAAVEAAPAVAAVLAEELGEDDAWQAREVESFRALAAGYMLG
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccttcccaccccgatccagccgcccagccgcgccgccctgctcgccaccctt
gagcgcgagccgcgctgggacgtgatcgtcatcggcggcggcgccaccggcctgggcacg
gcggtcgatgccgcctcgcgcgggtaccgcacgctgctggtcgaagccgcggactttgcc
aagggcacctcgagcaaggcgaccaagctggtgcacggcggcgtgcgctacctggcccag
ggcaatatcagcctggtgcgcgaggcgctgcacgagcgcggcctgctggcccgcaacgcg
ccgcacctggtgtggccgctgggcttcgtggtgccggcctaccagatgttcgaccagccc
ttctacggcatcggcctcaagctctacgacatgctggccggcagcctcaacctgtccggc
agccgctggctgaaccaccgcgaggtgctggccgccgcgcccaacctggccgaacatgtc
ggcgggcgcccgctgcgcggcggcaacctttacttcgacggccagttcgacgatgcgcgg
ctggcggtggcactgatgcggacgctgttcgacgtcggcggcaccgcgctcaactacctg
cgcgcgaccgggctgagccagcaaggcggcgtgatcagcggcgtgacggtgcaggacgtg
ctcggcggcggcacctaccggctgcgcgccgactgcgtgatcaacgccaccggcgtgtgg
gtcgatgccatccgccagatggaagacgggcatgcgcgcaccatggtcgcgcccagccag
ggcgtgcacctgacgctgccgcgcagtttcctgccgggcgagcgtgccatcctgatcccc
aagaccgacgacgggcgcgtgctcttcgtggtgccgtggaacgggcacaccatcgtcggc
accaccgacacgccgcgccgcgacctgccgctggagcccgatgccggcgccgacgatgtc
gatttcatcctcgaaacggcgtcgcgctacctggccagggaccccacccgcgccgacgtc
accagcgtctgggccggcctgcggccgctggtgcgggcgactggcgaggcctcgaccgct
tcgctgtcgcgcgagcatacgatcctggtgtccagggccgggctgatcaccgtcaccggc
ggcaaatggaccacctaccgcaagatggccgaagacgtgatcgagaccgcgatccagcgc
cagatggtgcgcgcggcgccgtgcatgacggcggagctgccgctgcacggcgccgccgga
ttgcccaccgacctgccgccgccggattccggttcgccggaccgctactacggcaacgag
ctcgggctgctgcgcgcgctgccggggcacgaccggatgctcgcgggcgcatcggggctg
accgaggcccatgtacgctttgccgcccggcatgaactggcgcgccgggtcgaggacgtg
ctggcacggcgcaaccgcgcgctgttcctggacgcccgcgcggcggtcgaggcggcaccg
gcggtggcggcggtcctggccgaagaactcggcgaagatgacgcctggcaggcacgcgag
gtggagagcttccgcgcgctcgccgccggctacatgctgggctga

DBGET integrated database retrieval system