KEGG   Cupriavidus taiwanensis: RALTA_A2051Help
Entry
RALTA_A2051       CDS       T00702                                 

Gene name
nagZ
Definition
(GenBank) Beta-hexosaminidase; N-acetyl-beta-glucosaminidase; Beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00520  Amino sugar and nucleotide sugar metabolism
cti01100  Metabolic pathways
cti01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RALTA_A2051 (nagZ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RALTA_A2051 (nagZ)
Enzymes [BR:cti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RALTA_A2051 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: CAQ69991
UniProt: B3R1Z4
LinkDB All DBs
Position
1:complement(2175313..2176380)
Genome map
AA seq 355 aa AA seqDB search
MNPTPSMSKKNSGKRPGPVVLDVVGKQLDAEDARRIAHPLTGGVILFARNFESRAQLEAL
TRAIRAVRDDVLICIDHEGGRVQRCKTDGFTHLPAMHRLGELWERDVLAATKAAVACGYV
LAAELRACDIDLSFTPVLDLDYGRSAVIGDRAFHADPRVVSMLAGHLNHGLLLAGMSNCG
KHFPGHGYVEADSHVAIPVDERTLDEILGQDARPYEWLGLSLASVMPAHVIYPKVDPSPA
GFSRYWLQDVLRAQLGFEGVIFSDDLSMEGASVAGNVTEAARAALTAGCDMVLICNHPDR
ADQLLSELDVDIDKMSRRRIRKLFARRKPLDWNKLHQQGEYRAALRTLQEHDLIA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccaaccccttccatgtccaagaagaattccggcaagcggccgggcccggtggtc
ctcgatgtcgtcggcaagcagctcgacgcggaagacgcgcgccgcatcgcgcatccgctc
accggcggcgtgatcctgttcgcgcgcaatttcgagtcgcgcgcgcagctggaggcgctg
acgcgtgccatccgcgcggtgcgcgacgacgtgctgatctgcatcgaccatgaaggcggt
cgcgtgcagcgctgcaagaccgatggcttcacccacctgccggcgatgcaccgcctgggc
gagctgtgggaacgcgacgtgctggccgcgaccaaggcggcggttgcctgtggctatgtg
ctggccgccgagctgcgcgcctgcgatatcgacctgagcttcaccccggtgctggacctc
gactacggccgcagcgccgtgatcggcgatcgcgccttccacgccgatccgcgcgtggtg
tcgatgctggccggccacctgaaccacggcctgctgctggccggcatgagcaactgcggc
aagcactttcccggccacggctacgtcgaggcggattcgcacgtggcgatcccggtcgac
gagcgcacgctggacgagatcctcggccaggacgcgcgcccgtatgaatggctgggcctg
tcgctggcgtcggtgatgccggcgcacgtgatctaccccaaggtcgatcccagcccggcg
ggcttctcgcgctactggctgcaggacgtgctgcgcgcacaactgggcttcgagggtgtg
atcttcagcgacgacctgagcatggaaggtgccagcgtcgccggcaacgtcaccgaggcc
gcgcgtgccgcgctgaccgccggctgcgacatggtgctgatctgcaaccacccggaccgt
gccgaccagctcctgagcgagctcgacgtggatatcgacaagatgtcgcgtcgccgcatc
cgcaagctgttcgcgcgacgcaagccgctggactggaacaagctgcaccagcagggcgag
taccgcgccgcgctgcgcacgctgcaggaacacgacctgatcgcctga

DBGET integrated database retrieval system