KEGG   Cupriavidus taiwanensis: RALTA_A2403Help
Entry
RALTA_A2403       CDS       T00702                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00620  Pyruvate metabolism
cti00680  Methane metabolism
cti00710  Carbon fixation in photosynthetic organisms
cti01100  Metabolic pathways
cti01120  Microbial metabolism in diverse environments
cti01200  Carbon metabolism
Module
cti_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RALTA_A2403 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RALTA_A2403 (ppc)
   00680 Methane metabolism
    RALTA_A2403 (ppc)
Enzymes [BR:cti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RALTA_A2403 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAQ70337
UniProt: B3R612
LinkDB All DBs
Position
1:2543162..2546191
Genome map
AA seq 1009 aa AA seqDB search
MTQHAARPNGRKTGGAAKDSSAAKGDASGATSAKPPRSAPRAAKRSTKPTLSIVSSNGTT
IAPTPARRTTDKDVPLREDIRFLGRLLGDCLREQEGDAAFEVVETIRQTAVRFRRENDRA
AGAELDRLLKRLSRDQTNQVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQAGSLQH
ALEKIDAAGVTGKQLRKFLDEALIVPVLTAHPTEVQRKSILDAEREIARLLAERDLPMTA
RERDHNTAQLRAKVTTLWQTRMLRDARLTVADEIENALSYYRTTFLRGIPQLMSELEEDI
AAVFPATRRRKGAPGDAKTAPLSPFLQMGSWIGGDRDGNPNVTAETLEHAAGQQAQLILD
WYLEEVHALGAELSMSMLMVDASPELLALAERSPDHSEHRADEPYRRALIGIYARLAATC
KALSGHAATRRPVAPAEPYDSAEAFGADIQVVIDSLRAHHGQALASHRIDALARAIAVFG
FHLASVDMRQVSDVHEAVIAELFAAAGIAPDYAALPEQRKLELLLAELRQPRLLTLPWHE
YSEQTRKELAIFAAARELRARYGKRVARNYIISHTETLSDLVEVMLLQKESGMLRGTLGS
KTDPARMELMVIPLFETIEDLRNAAGIMQSLLDLPGFDAVLAHHGVEQEVMLGYSDSNKD
GGFLTSNWELYKAELALVQLFEQRNVKLRLFHGRGGTVGRGGGPTYDAILSQPPGTVNGQ
IRLTEQGEIINSKFANAEIGRRNLETVVAATLEASLLPQQNAPKDLDTFEAVMQQLSDRA
FTAYRDLVYETPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKNRRIEDLRAIPWGFS
WGQCRLLLPGWYGFGSAVRSLLDSAPDDKARKQAVTTLRRMVKTWPFFSTLLSNMDMVLA
KTDLAVASRYAQLCDDAALRRNVFNRISKEWHLTCDMLALITGHQERLADNPLLARSIKN
RFAYLDPLNHLQVELLKRYRAGKDGDDIRVRRGIHLTINGVAAGLRNTG
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcatgctgcgcggcccaacggtcggaagaccggcggcgccgccaaggattcg
tccgccgcgaaaggtgacgcaagcggcgcaaccagcgccaaaccgccccgctccgccccc
cgcgcagccaagcgttccaccaagcccacgctttccatcgtgtcgagcaacggaaccacc
atcgcccccactcccgcccgccgcaccaccgacaaggacgtgccgctgcgcgaggacatc
cgcttcctgggccgcctgctgggcgactgcctgcgcgagcaggaaggcgacgccgccttc
gaggtggtcgagaccatccgccagaccgcggtgcgcttccgccgcgaaaacgaccgcgcc
gccggcgccgagctggaccgcctgctcaagcgcctgtcgcgcgaccagaccaaccaggtg
gtgcgcgcgttcagctatttctcgcacctggccaatattgccgaggaccagcaccacaac
cgccgccgccgcgtgcatgcgctggccggctcgccgccgcaggccggcagcctgcagcac
gcgctggaaaagatcgatgccgccggcgttaccggcaagcagctgcgcaagttcctggac
gaggcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtccagcgcaagagcatc
ctcgacgccgaacgcgagatcgcccgcctgctggccgagcgcgacctgccgatgaccgcg
cgcgagcgcgatcacaacaccgcgcagctgcgcgccaaggtcaccacgctgtggcagacc
cgcatgctgcgcgacgcgcgcctgacggtggccgacgagatcgagaacgcgctgtcgtac
taccgcaccaccttcctgcgcggcatcccgcagctgatgagcgagctggaagaagacatc
gccgcggtgttccccgccacgcggcggcgcaagggcgcccccggcgacgccaagacggcg
ccgctgtcgccgttcctgcagatgggttcctggatcggcggcgaccgcgacggcaatccc
aacgtgaccgccgaaacgctggagcacgccgccggccagcaggcgcagctcatcctggac
tggtacctggaagaagtgcatgcgctcggcgccgagctgtcgatgtcgatgctgatggtc
gacgccagcccggaactgctggcgctggccgagcgctcgcccgaccattccgagcaccgc
gccgacgaaccgtaccggcgcgcgctgatcggcatctacgcccgcctggcggccacctgc
aaggcgctgagcggccatgccgcgacccgccgcccggtggcgccggccgagccctatgac
agcgccgaggccttcggcgccgacatccaggtcgtcatcgattccctgcgcgcgcaccac
ggccaggcgctggccagccaccgcatcgacgcgctcgcgcgcgccatcgccgtgtttggc
ttccacctggcctcggtcgacatgcgccaggtgtcggacgtgcacgaggcggtcatcgcc
gaactgttcgccgccgccggcatcgcccccgactacgccgcgctgcccgagcaacgcaag
ctggaactgctgctggccgaactgcgccagccgcgcctgctgacgctgccgtggcacgag
tactcggagcagacccgcaaggaactggcgatctttgccgccgcgcgcgagctgcgggcg
cgctatggcaagcgcgtggcgcgcaactacatcatctcgcacaccgagacgctgtcggac
ctggtcgaggtgatgctgctgcagaaggaatcgggcatgctgcggggcacgctgggcagc
aagaccgacccggcgcgcatggaactgatggtgatcccgctgttcgagaccatcgaagac
ttgcgcaacgccgccggcatcatgcagtcgctgctggacctgccgggcttcgatgccgtg
ctcgcgcaccatggggtcgagcaggaagtgatgctcggctactcggattcgaacaaggac
ggcggcttcctgacgtccaactgggagctgtacaaggccgagctggcgctggtgcagctg
ttcgagcagcgcaacgtcaagctgcgcctgttccacggccgcggcggcaccgtcggccgc
ggcggcggcccgacctacgacgccatcctgtcgcagccgccgggcaccgtgaacggccag
atccgcctgaccgagcagggcgagatcatcaacagcaagttcgccaacgccgagatcggc
cggcgcaacctggaaacggtggtcgccgccacgctagaggcctcgctgctgccgcagcag
aacgcgccgaaggacctggacaccttcgaggccgtcatgcagcagttgtcggaccgcgcc
ttcaccgcttatcgcgacctggtctacgagacccccggcttcaaggactacttcttcgcc
accacgccgatcaccgagatcgccgacctgaacctcggttcgcgtccggcctcgcgcaag
ctgatggacaagaagaaccgccgcatcgaagacctgcgcgcgatcccatggggtttctcg
tggggtcaatgccgcctgctgctgccgggctggtacggcttcggcagcgcggtccgctcg
ctgctcgacagcgcgccggatgacaaggcgcgcaagcaggccgtcaccacgctgcggcgc
atggtcaagacctggccgttcttctcgacgctgctgtccaacatggacatggtgctggcc
aagaccgacctggcggtagcctcgcgctacgcccagctgtgcgacgacgcggcgctgcgc
cgcaacgtgttcaaccgcatcagcaaggaatggcacctgacctgcgacatgctggcgctg
atcaccggccaccaggagcggctggcggacaacccgctgctggcgcgctcgatcaagaac
cgctttgcgtatctcgatccgctgaaccacttgcaggtggagctgctcaagcgctaccgg
gcgggcaaggacggcgatgatatccgcgtacggcgcgggatccacctgaccatcaatggg
gtggcggcaggattgcgcaatacgggctga

DBGET integrated database retrieval system