KEGG   Cupriavidus taiwanensis: RALTA_A2894Help
Entry
RALTA_A2894       CDS       T00702                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01130  Biosynthesis of antibiotics
cti01230  Biosynthesis of amino acids
Module
cti_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RALTA_A2894 (aroK)
Enzymes [BR:cti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     RALTA_A2894 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 AAA_16 FtsK_gamma Cytidylate_kin AAA APS_kinase TsaE AAA_22 AAA_17 ATP_bind_2
Motif
Other DBs
NCBI-ProteinID: CAQ70819
UniProt: B3R7B9
LinkDB All DBs
Position
1:complement(3066707..3067474)
Genome map
AA seq 255 aa AA seqDB search
MPAAPQHKKMMQFPTGEDGPHAALPNHSPVTAQETGPAAQRRAQDRRDADRSDSERPESD
RPNLFFVGLMGAGKTTVGRTVARRLHYPFFDSDHELEAHCGVRIPVIFELEGEAGFRDRE
AAMIRELAQRQGIVLATGGGAVLRAENREVLKARGTVVYLRASPHDLWLRTRHDRNRPLL
QTDDPKGKLEALYAERDPLYREVADFIIETGKPSVAQLANMVLMQLEMAGFRIDPPQPAS
PPADDAEPPAQDPNP
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgccggccgcgccacaacataagaagatgatgcagttcccaaccggggaggacggcccg
catgccgcgctcccgaaccacagtcccgtgacagcccaagagaccggcccggcggcacag
cgccgggcccaggatcggcgcgatgccgatcgatctgactccgagcgaccggaatccgat
cgacccaacctctttttcgtcggcctgatgggcgccggcaagaccaccgtgggccgcacg
gtggcgcggcgcctgcactatccgtttttcgattccgaccatgagctggaggcgcactgc
ggcgtgcgcatcccggtgatcttcgagctcgagggcgaggccggcttccgcgaccgcgag
gccgcgatgatccgcgaactggcgcagcgccagggcatcgtgctggccacaggcggcggt
gcggtgctgcgcgccgaaaaccgcgaggtgctgaaggcccgcggcacggtggtgtacctg
cgcgccagcccgcacgacctgtggctgcgcacgcggcatgaccgcaaccgaccgctgctg
cagaccgacgatcccaagggcaagctcgaggcgctgtacgccgagcgcgatccgctctac
cgcgaagtcgccgatttcatcatcgaaaccggcaagccctcggtggcgcagcttgctaat
atggtgttgatgcaacttgaaatggccggtttccggatcgatcccccgcagccggcgtcc
ccgcccgcggacgatgccgaacccccggcgcaggaccccaatccatga

DBGET integrated database retrieval system